KEGG   Brucella ovis: BOV_2026Help
Entry
BOV_2026          CDS       T00534                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bov  Brucella ovis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BOV_2026 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BOV_2026 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BOV_2026 (trpB)
Enzymes [BR:bov01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BOV_2026 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(2038859..2040127)
Genome map
AA seq 422 aa AA seqDB search
MLSHSPGAPEHDGAETLNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYE
TAKNDPEFKAKLNALSTFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCL
GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCIVYMGATDVERQKPNVFRMKLL
GAEVKPVSAGNGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEA
RQQILEQEGRLPDVIVAAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMS
AGRPGVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEA
LDAFQLCTRTEGIIPALESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGM
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctcagccattcgccaggcgcgcctgaacatgacggagcggaaacgttgaacaagccg
gttgcacccaattcctacaagacgggccctgacgaagagggcatgttcggcatattcggt
ggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcagcaggcttatgaa
acggcgaagaatgaccccgaattcaaggcgaagttgaacgccctttccaccttttatgcc
ggccgtccttccaagctctattatgccgaaggcctgagcaaacatctgggtggcgctaaa
atctacttcaagcgcgaagacctgaaccataccggcagccacaagatcaacaattgcctt
ggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgcagaaacgggcgcc
ggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctgccctgtatcgtc
tatatgggcgcaaccgacgtggagcgccagaagcccaatgttttccgcatgaagctgctc
ggcgcggaagtgaagccggtttctgctggcaatggcacgctgaaagacgcgatgaacgaa
gccctgcgtgactgggttacgaatgtcgaggatacctattacctgatcggcacggctgcc
ggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatcggcaccgaagcg
cgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtggcagcggtcggt
ggcggctccaacgccattggcctgttccatccgttcctcgacgacgcctcggtgaagatc
gtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgcgcttcgatgagc
gcaggccgccccggcgttctgcatggcaaccgcacctatctcctccagaacgcggatggc
caaattctggaaggccattcggtttccgctggtctcgactatccgggcgtcgggcccgag
cattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctcgacaatgaggcg
ctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcgctcgaatccgcc
catgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggacaaggtgatgatc
gtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaagcttctcggcatg
gatatctga

DBGET integrated database retrieval system