KEGG   Brucella ovis: BOV_2026Help
Entry
BOV_2026          CDS       T00534                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bov  Brucella ovis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BOV_2026 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BOV_2026 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BOV_2026 (trpB)
Enzymes [BR:bov01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BOV_2026 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2038859..2040127)
Genome map
AA seq 422 aa AA seqDB search
MLSHSPGAPEHDGAETLNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYE
TAKNDPEFKAKLNALSTFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCL
GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCIVYMGATDVERQKPNVFRMKLL
GAEVKPVSAGNGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEA
RQQILEQEGRLPDVIVAAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMS
AGRPGVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEA
LDAFQLCTRTEGIIPALESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGM
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctcagccattcgccaggcgcgcctgaacatgacggagcggaaacgttgaacaagccg
gttgcacccaattcctacaagacgggccctgacgaagagggcatgttcggcatattcggt
ggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcagcaggcttatgaa
acggcgaagaatgaccccgaattcaaggcgaagttgaacgccctttccaccttttatgcc
ggccgtccttccaagctctattatgccgaaggcctgagcaaacatctgggtggcgctaaa
atctacttcaagcgcgaagacctgaaccataccggcagccacaagatcaacaattgcctt
ggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgcagaaacgggcgcc
ggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctgccctgtatcgtc
tatatgggcgcaaccgacgtggagcgccagaagcccaatgttttccgcatgaagctgctc
ggcgcggaagtgaagccggtttctgctggcaatggcacgctgaaagacgcgatgaacgaa
gccctgcgtgactgggttacgaatgtcgaggatacctattacctgatcggcacggctgcc
ggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatcggcaccgaagcg
cgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtggcagcggtcggt
ggcggctccaacgccattggcctgttccatccgttcctcgacgacgcctcggtgaagatc
gtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgcgcttcgatgagc
gcaggccgccccggcgttctgcatggcaaccgcacctatctcctccagaacgcggatggc
caaattctggaaggccattcggtttccgctggtctcgactatccgggcgtcgggcccgag
cattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctcgacaatgaggcg
ctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcgctcgaatccgcc
catgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggacaaggtgatgatc
gtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaagcttctcggcatg
gatatctga

DBGET integrated database retrieval system