KEGG   Brucella ovis: BOV_2097Help
Entry
BOV_2097          CDS       T00534                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bov  Brucella ovis
Pathway
bov00071  Fatty acid degradation
bov00280  Valine, leucine and isoleucine degradation
bov00281  Geraniol degradation
bov00310  Lysine degradation
bov00360  Phenylalanine metabolism
bov00362  Benzoate degradation
bov00380  Tryptophan metabolism
bov00410  beta-Alanine metabolism
bov00627  Aminobenzoate degradation
bov00640  Propanoate metabolism
bov00650  Butanoate metabolism
bov00903  Limonene and pinene degradation
bov00930  Caprolactam degradation
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01120  Microbial metabolism in diverse environments
bov01130  Biosynthesis of antibiotics
bov01212  Fatty acid metabolism
Module
bov_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BOV_2097
   00650 Butanoate metabolism
    BOV_2097
  Lipid metabolism
   00071 Fatty acid degradation
    BOV_2097
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BOV_2097
   00310 Lysine degradation
    BOV_2097
   00360 Phenylalanine metabolism
    BOV_2097
   00380 Tryptophan metabolism
    BOV_2097
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BOV_2097
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BOV_2097
   00281 Geraniol degradation
    BOV_2097
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BOV_2097
   00627 Aminobenzoate degradation
    BOV_2097
   00930 Caprolactam degradation
    BOV_2097
Enzymes [BR:bov01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BOV_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABQ60559
UniProt: A0A0H3AQK6
Position
I:2109788..2110561
Genome map
AA seq 257 aa AA seqDB search
MAYETIIVETRDSVGLIRLNRPQALNALNRAVLEELTDALAAFDADGKVGAVVLTGSEKA
FAAGADIKEMQSINFVDAYLQDMFADWQKVDRIRKPIIAAVSGYALGGGCELAMMCDFII
AGSNAKFGQPEITLGVIPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERCGLVSRVV
APEALLEEALKAAERIASFSRVSVYMAKEAVNRAYETTLDEGLRFERRLFHSLFATEDQQ
EGMSAFVDKRTPSFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaaacaatcatcgttgagacgcgtgacagcgttggtctcatccgtctcaac
cgtccgcaggcgctcaacgcgctcaatcgcgccgtgcttgaggagctgaccgatgcgctt
gccgccttcgacgcggatggcaaggtcggcgccgtggtgctgaccggctcggaaaaggct
ttcgccgccggggccgacatcaaggaaatgcagtcgatcaatttcgtcgatgcctatttg
caggacatgttcgccgactggcagaaggtggatcgtatccgcaagccgattatcgcggct
gtttcgggctatgcgctgggcggcggctgcgaactcgccatgatgtgcgatttcatcatc
gcgggcagcaatgcgaaattcggccagccggaaatcacgctgggcgtcattcctggcatg
ggcggctcgcagcgcctgacgcgctatgtcggcaagtccaaggctatggatatgtgcctg
acgggccgcatgatggatgcagccgaagcggagcgttgcggccttgtttcccgcgttgtc
gcaccggaggctcttctggaagaggcactgaaagcagccgaacgcatcgcatccttctcg
cgcgtctcggtctatatggccaaggaagcggtcaaccgcgcctatgaaacgacgctggac
gagggcctgcgtttcgagcgccgcctgttccattcgcttttcgcgaccgaagaccagcag
gaaggcatgtccgctttcgttgataaacgtaccccttccttcaagaaccgctga

DBGET integrated database retrieval system