KEGG   Brucella ovis: BOV_A0816Help
Entry
BOV_A0816         CDS       T00534                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bov  Brucella ovis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BOV_A0816 (tpiA)
   01230 Biosynthesis of amino acids
    BOV_A0816 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BOV_A0816 (tpiA)
   00051 Fructose and mannose metabolism
    BOV_A0816 (tpiA)
   00562 Inositol phosphate metabolism
    BOV_A0816 (tpiA)
Enzymes [BR:bov01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BOV_A0816 (tpiA)
Exosome [BR:bov04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BOV_A0816 (tpiA)
  Exosomal proteins of bladder cancer cells
   BOV_A0816 (tpiA)
  Exosomal proteins of melanoma cells
   BOV_A0816 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:856249..857019
Genome map
AA seq 256 aa AA seqDB search
MTKFWIGTSWKMNKTLAEARLFAEALKAADAGRSPDIQRFVIPPFTAVREVKEILSGTSV
KVGAQNMHWADQGAWTGEISPLMLKDCNLDIVELGHSERREHFGETNETVGLKVEAAVRH
GLIPLICIGETLEDRESGRAAAVLEEEVRGALSKLSEAQKQAEILFAYEPVWAIGENGIP
ASADYADARQAEIIAVAQSVLARRVPCLYGGSVNPGNCEELIACPHIDGLFIGRSAWNAE
GYLDILARCATKVQAN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattctggattggcacaagctggaaaatgaacaagacgctggccgaagcccgc
cttttcgcggaagcgctgaaagccgccgatgcaggccgctcgccagacatccagcgtttt
gtcatcccgcctttcaccgccgtgcgtgaggtgaaggaaatcctctccggcacatccgtg
aaggtcggcgcgcagaacatgcactgggccgatcagggtgcatggaccggcgaaatctcc
ccgctgatgctgaaagattgcaatctcgacattgttgaactgggccattcggagcgccgc
gaacatttcggcgagaccaacgagacggtcggcttgaaagtggaagccgccgtgcgccac
ggcctgatcccgctcatctgcatcggtgaaacgctggaagaccgtgaaagcggacgcgca
gccgcggtgcttgaagaagaagtgcgcggcgcgctttccaagctttccgaggcgcagaag
caggccgaaatcctcttcgcctatgagccagtctgggccatcggcgaaaacggcattccc
gcttccgccgactatgccgatgcgcgacaggccgaaatcatcgcggtggcacaaagcgtg
ctcgctcgccgcgtgccgtgcctttatggcggctcggtcaatccgggcaattgcgaagaa
ctgatcgcctgcccgcatatcgatgggcttttcatcggccgttcggcgtggaacgccgaa
ggctatctcgacattctggccaggtgcgccaccaaggttcaagcgaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system