KEGG   Bordetella parapertussis 12822: BPP0123Help
Entry
BPP0123           CDS       T00140                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
129810..131684
Genome map
AA seq 624 aa AA seqDB search
MCGVAGLIHLDGAAVDPAVLQGMTDAIAHRGPDGEGHWIDGNVGLGHRRLAIIDLSPAGH
QPMISADSRYVLSYNGEIYNFRELRAELETAGYRFKSRTDSEVLLYAVIAWGLKALKRFN
GMFAFALWDCHERRLILARDRYGIKPLYYAEQGGTLAFGSEQKAILALPGFRRKLDKAAL
LEYFTFQNIFTSKVLLEDIQILPAGHYAIVEPDRCASISLTQYWDFCFREPDVAATDQEY
REELDRLFVQAVKRQLVTDVELGSYLSGGMDSGSIAAVAAAEHPYIKTFTCGFDLNSASG
IELGFDERSKAEYMSYCFKTEHYEMVLKAGDMERILPHVACHLEEPRVGQSYPNFFAAKL
ASRFVKVVLSGAGGDELFAGYPWRYYRAVVNDDFEHYVDKYYNFWQRLLPNSELKRVFAP
IAGEVEHVWTRDIFRNVFRHHADQLYRPEDYINHSLYFEAKTFLHGLLVVEDKLSMAHGL
ETRVPFLDNDLVEFAMRCPIRLKLNNLAEVVKINENETGNKVRKFFEKNRDGKTILREVM
NHRLPADISKAEKQGFSAPDASWFKGESLEFVRRKLLDGHSPLYEIMDAATVRELVNEHL
GGIRNRRLLIWSLLSVDAWMRQTF
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcgttgccggtttgatccatctagacggtgccgcggtcgaccccgcggtactg
cagggcatgaccgatgccatcgcgcatcgcgggccggatggagaaggccattggattgac
ggcaatgtcggcctcggccaccggagactggcgatcattgacctttcgccggccggccat
cagcccatgatttcggccgattcgcgctatgtactgagctacaacggcgagatctacaac
tttcgcgagttgcgggccgagcttgaaaccgcaggatatcggttcaagtcgcgtaccgac
agcgaagtcctgctgtatgccgtcattgcctggggcttgaaagcgctgaagcgcttcaat
ggcatgttcgcgtttgcgctgtgggattgccatgagcggcggttgatactggcgcgcgat
cgctacgggatcaaaccactgtattacgccgagcagggtgggacgctggcgttcggttca
gagcaaaaagccatactggctttgccgggatttcgccgcaagctggacaaggccgcgctg
cttgaatattttacgttccagaatatctttaccagcaaggtgttgttggaggatattcag
atattgccagccggccattacgcgatcgtagagccggatcgttgcgcgtcgatttccctc
acccagtattgggatttttgtttccgggagccggacgtcgccgccacagaccaggaatat
cgcgaggagttggatcggctgtttgtccaggccgtgaagcggcagctcgtcacggatgtc
gagcttgggagctacctgagcggcggcatggattcgggctccattgccgccgtggcggcc
gctgaacatccctacataaagacctttacctgtggctttgacctgaactccgcctctggt
atcgaactgggcttcgacgagcgcagcaaagccgagtacatgtcatattgcttcaagacg
gagcattatgaaatggtcctgaaggccggcgatatggagcgtatcctgccgcatgtcgcc
tgccatctggaagagccgcgggtcggtcaaagttatcccaatttcttcgccgccaagctg
gcatccagattcgtcaaggtagtgctgtccggcgcgggcggagatgagcttttcgcaggc
tatccctggcgctactatcgcgcagtcgttaatgacgatttcgagcattacgtcgacaaa
tactacaacttttggcagcggttgctgccaaacagtgaattgaagcgtgtgttcgctccg
attgccggcgaagtcgaacatgtatggacgcgcgatatttttcgcaatgtgttccggcac
catgctgaccagctgtatcggcccgaggattacatcaatcattcgctgtatttcgaggcg
aaaaccttcctgcatggcctgctggtcgtcgaagacaagctgagcatggcgcacggcctg
gaaacgcgcgtgcccttccttgacaacgacttggtggagttcgcgatgcgatgtccgatt
cgcctgaagctgaacaatctggccgaagtcgtcaagatcaacgagaacgaaaccggcaac
aaggtaaggaagttttttgaaaagaaccgggacggcaagaccatcctgcgcgaggtcatg
aatcatcgcttgccggccgacatttccaaggcggagaagcaggggttttcggcgccggac
gccagctggttcaagggggaaagcctggagttcgtcaggcgcaaattgcttgatggccat
tcccctctgtatgaaatcatggatgcggcgacggtgcgtgaactcgtcaatgaacatctt
ggcggcatacggaatcgccgtctgctcatctggtctttgctgagcgtagatgcatggatg
cggcagacattctga

DBGET integrated database retrieval system