KEGG   Bordetella parapertussis 12822: BPP0142Help
Entry
BPP0142           CDS       T00140                                 

Gene name
wbmC
Definition
glutamine amidotransferase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPP0142 (wbmC)
Enzymes [BR:bpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BPP0142 (wbmC)
Peptidases [BR:bpa01002]
 Cysteine Peptidases
  Family C44
   BPP0142 (wbmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(154266..156152)
Genome map
AA seq 628 aa AA seqDB search
MCGVLGAWWRHHDEHEDARFAAGLRKLAHRGPDDRGSEHFAAPHGRLSLGHTRLAVIDLS
AAGHQPMHADADRLAVVFNGEIYNYRELRSELRQIDAIFRGDSDTEVLLAAWQHWGVAAL
RRFKGMFAFALYDRRQQTLTLARDAFGIKPMYYHAAPERLLFGSELPAVQALLPHPPRLN
WQRAYDYLAYGQYDQPPDTFIAGIRQLPAGHLLTLDLRTGRAGEPMAWDDPASQECRPIG
FQEAAEELRARFLDNVRLHLRSDVPIGAALSGGIDSSAIVCAMRWLEPDLPIQTFSFISD
DAHRSEERWVDLVNQHCGATGHKIHIAPHELLDDLDDLIRVQGEPVGSTSIYAQYRVFKL
AREHGVVVTLDGQGADELLGGYGGYPTERLASLLETSRLGAAARLLRQQGRGAPARLLQA
AALAAGGRHLANLRHATGRQHAPAWLDAQVLRDQGVTMREPAHAWAAATPLRGRRLVNEL
AHALYHRGLGALLRHGDRNSMRFSVESRVPFLTQDLAEFALSLPERYLVSDSGQTKHIFR
KAMRGIVPDLILDRDDKIGFATPEQQWMQATAPQMRQWLVDAADIPFLRNAEVTAQFDAM
IAGATPFSWQAWRWVNFQRWMQHATVLP
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtgtattgggcgcatggtggcgacaccacgacgaacacgaagacgcgcgcttt
gccgccggactacggaagctggcccacagagggcccgacgatcgcggcagcgagcacttc
gccgcgccgcacggacgcttgtcgctgggacatacccggttggcggtcatcgacctgagc
gcggccggccaccagcccatgcatgccgacgccgatcgcctggccgtcgtgttcaacggt
gaaatctacaattaccgggaactgcgatccgaactgcggcaaatcgacgcgatcttccgc
ggcgacagcgatacggaggtattgctggctgcctggcagcattggggcgtcgccgcgctg
cgccgcttcaagggcatgttcgccttcgcgctgtacgatcgccggcaacagacgctgacc
ctggcgcgggatgccttcggcatcaagccgatgtactaccatgcggccccggaacgcctg
ctgttcggctcggaattgccggccgtccaggccctgctgccgcaccctccgcgcctgaac
tggcagcgcgcctatgattacctggcctacgggcagtacgaccagccgccagacaccttc
attgccggcatccggcagctgccggccggccacctgttgacgctggacctgcgcacgggc
cgggcgggcgagcctatggcatgggatgacccggcatcgcaggaatgccggcccatcggg
ttccaggaggcggccgaggaactgcgcgcccgcttcctggacaacgtccgcctgcacctg
cgcagcgacgtcccgatcggcgccgccctgtccggcggcatcgattcctcggccatcgta
tgcgccatgcgctggctggaacccgacctgcccatccagacattcagtttcatctccgac
gatgcgcaccgctcggaagagcgctgggtcgacctggtgaaccaacattgcggcgccacc
ggccacaagatacatatcgccccgcacgaactcctggacgacctggacgacctcatccgc
gtgcagggcgaacccgtgggcagcaccagcatctacgcccagtaccgggttttcaagctg
gcacgcgaacatggcgtcgtcgtgaccctggatggccaaggcgcggacgaactgctgggc
ggctacggcggatacccgaccgagcgcctcgccagcctgcttgaaaccagccgccttggc
gccgccgccaggctgctgaggcagcaaggccgcggcgcgcccgcccggctgttgcaggcc
gccgcgctggccgccggcggccgccacctggccaacctgcggcatgccacgggccggcag
cacgcccctgcctggctggatgcgcaggtcttgcgcgaccagggcgtgaccatgcgcgag
cccgcccatgcctgggcggccgccacgcccctgcgcggacgccgcctcgtcaacgaactg
gcgcacgcgctgtatcaccgcggcctgggcgccctgttgcggcacggcgacaggaactcc
atgcggttctccgtcgaaagccgcgtgcccttcctgacccaggatcttgcggagttcgcc
ctgagccttccggaacgctacctcgtctccgactcgggtcaaaccaagcacatttttcgc
aaggccatgcgtgggattgttccggatttgatcctggatagggatgataaaatcggcttc
gcgacccctgagcaacagtggatgcaggctacagcgcctcagatgcgtcaatggctggtg
gacgccgcggacattccatttctgcgcaacgccgaagtcaccgcgcagttcgacgccatg
atcgccggcgcgacgccgttttcctggcaggcgtggcgctgggtgaatttccagcggtgg
atgcagcacgcgacggttctgccataa

DBGET integrated database retrieval system