KEGG   Bordetella parapertussis 12822: BPP0171Help
Entry
BPP0171           CDS       T00140                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BPP0171 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPP0171 (rfbC)
Enzymes [BR:bpa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BPP0171 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(184795..185343)
Genome map
AA seq 182 aa AA seqDB search
MKLTPLAIADVVLIEPQVFGDERGCFFESFNQDRLDAQLGRRIRFVQDNHSCSRAGVLRG
LHYQILHPQAKLVRVVAGEAYDVAVDLRRGSPTFGRWTGAYLSARNRHQLWIPEGFAHGF
LALSDDTECLYKATDYYAPEHERCVRWDDPQLKVDWPLQGQAPILSVKDRQGVALARADT
YA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacccccttggccatcgcggacgtcgtgctgatcgaaccccaagtgttcggc
gacgagcgcggctgcttcttcgagagcttcaaccaggaccgcctggacgcgcaactgggg
cgccgcatccgcttcgtgcaggacaatcactcatgctcgcgcgcgggggtgctgcgcggc
ctgcactaccagatcctgcatccgcaggccaagctggtgcgcgtggtggcgggcgaagcc
tatgacgtggcggtggacctgcgccgcggctcgcccaccttcgggcgctggaccggcgcc
tacctgtcggcgcgcaaccggcaccagctgtggattccggaagggtttgcgcacggcttc
ctggcgttgtccgacgataccgagtgcctgtacaaggccaccgactactacgcgcccgaa
catgagcgctgcgtgcgctgggacgacccgcaactcaaggtggactggccgctgcagggc
caagcgcccatcctgtcggtgaaagaccgccagggcgtggcgctggcgcgggccgatacc
tatgcgtag

DBGET integrated database retrieval system