KEGG   Bordetella parapertussis 12822: BPP0171Help
Entry
BPP0171           CDS       T00140                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00521  Streptomycin biosynthesis
bpa00523  Polyketide sugar unit biosynthesis
bpa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BPP0171 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPP0171 (rfbC)
Enzymes [BR:bpa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BPP0171 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CAE39912
GeneDB: BPP0171
UniProt: Q7W221
Position
complement(184795..185343)
Genome map
AA seq 182 aa AA seqDB search
MKLTPLAIADVVLIEPQVFGDERGCFFESFNQDRLDAQLGRRIRFVQDNHSCSRAGVLRG
LHYQILHPQAKLVRVVAGEAYDVAVDLRRGSPTFGRWTGAYLSARNRHQLWIPEGFAHGF
LALSDDTECLYKATDYYAPEHERCVRWDDPQLKVDWPLQGQAPILSVKDRQGVALARADT
YA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacccccttggccatcgcggacgtcgtgctgatcgaaccccaagtgttcggc
gacgagcgcggctgcttcttcgagagcttcaaccaggaccgcctggacgcgcaactgggg
cgccgcatccgcttcgtgcaggacaatcactcatgctcgcgcgcgggggtgctgcgcggc
ctgcactaccagatcctgcatccgcaggccaagctggtgcgcgtggtggcgggcgaagcc
tatgacgtggcggtggacctgcgccgcggctcgcccaccttcgggcgctggaccggcgcc
tacctgtcggcgcgcaaccggcaccagctgtggattccggaagggtttgcgcacggcttc
ctggcgttgtccgacgataccgagtgcctgtacaaggccaccgactactacgcgcccgaa
catgagcgctgcgtgcgctgggacgacccgcaactcaaggtggactggccgctgcagggc
caagcgcccatcctgtcggtgaaagaccgccagggcgtggcgctggcgcgggccgatacc
tatgcgtag

DBGET integrated database retrieval system