KEGG   Bordetella parapertussis 12822: BPP0295Help
Entry
BPP0295           CDS       T00140                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPP0295 (gpmA)
   01230 Biosynthesis of amino acids
    BPP0295 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP0295 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BPP0295 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPP0295 (gpmA)
Enzymes [BR:bpa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPP0295 (gpmA)
Exosome [BR:bpa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPP0295 (gpmA)
  Exosomal proteins of melanoma cells
   BPP0295 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
304890..305642
Genome map
AA seq 250 aa AA seqDB search
MYKLVLIRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKR
AIRTLWIALDALDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLDLEDPRHPRFDGRYAKIPADQLPATECLKDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDNVSDDDIVGVNIPTGQPLVYELDEDLKPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaacttgttctgatacgccacggcgaaagccagtggaacctggaaaaccgtttc
acgggctggaccgatgtggacctgaccgaaaccggccgcgagcaggcccgcaaggcgggc
gaattgctcaagcgcgagggctacgccttcgacctggcctatacctcggtgctcaagcgc
gctatccgtacgctctggatcgccctggacgccctggacgccatgtataccccggtgggc
atcaactggcgcctgaacgagcgccactacggccagctgcaaggcctgaacaaggccgag
accgccgccaagtacggcgacgagcaggtgctgatctggcgccgcgcctacgcgatcgcc
ccggagccgctggacctggaagatccgcgccacccgcgtttcgatggccgctacgctaag
attccggccgaccagctgccggccaccgaatgcctgaaggatacggtggcgcgcgtgctg
ccgttctggaacgaatcgatcgccccggccatccgcgccggccgccgcgtcctggtggcc
gcgcatggcaacagcctgcgcgcgctgatcaagcacctcgacaatgtttccgatgatgac
atcgtgggcgtgaatattccgaccggccagcctctggtgtatgaattggatgaggacctg
aagccgattcgccactattatctgggcgatgccgccgagatcgaggcggcgatggctgcc
gtggcggcgcagggcaaggcgaaaaaggactga

DBGET integrated database retrieval system