KEGG   Bordetella parapertussis 12822: BPP0573Help
Entry
BPP0573           CDS       T00140                                 

Definition
hypothetical protein
Orthology
K01799  
maleate isomerase [EC:5.2.1.1]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BPP0573
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BPP0573
Enzymes [BR:bpa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.1  maleate isomerase
     BPP0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(606409..607212)
Genome map
AA seq 267 aa AA seqDB search
MLTAMNTPAHTLMPYDAALRSFPGLLRAPEAARTRLGVILPSVNTVVEPWFGQAVAADVR
VHATRMLLASEVTAEALRRMDHEEGLDAARRIASCRPDAIAYCCTASSIVQGLDYDRRLR
QSLEEATGKPCFTAVGAIIEALQACNARKIAIASPYTDAIDHAEKAFFEEAGFQVLNAAN
LNIAESFALAAPDARQMYELAQRAWHPDADALLISCLNMHAQEVVGLLEQQLGRPVITST
TATLWKLLRSAGRADRIPGYGRLLAEH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccgccatgaacacgccggcccacacattgatgccctacgacgcggcgctgcgc
agcttccccgggctgctgcgcgcgcccgaggcggcgcgcacgcggcttggagtgatcctg
cccagcgtcaataccgtggtcgagccctggttcggccaggccgtcgcggccgacgtccgc
gtgcacgcgacccgcatgctgctggccagcgaagtcacggccgaagcgctgcggcgcatg
gaccacgaggaagggctcgacgcggcgcggcgcatcgccagctgccgtccggacgcgatt
gcctactgctgcacggcttccagcatcgtccaggggctggattacgaccggcgcctgcgg
caatcgctcgaggaagcgaccggcaagccgtgcttcacggccgtcggggcgatcatcgag
gcattgcaggcatgcaacgcgcgcaagatcgccatcgcctctccgtataccgacgcgatc
gatcatgccgaaaaggcattcttcgaggaagcgggcttccaggtgttgaacgccgccaac
ctgaacatcgccgaatcgttcgcgctggcggcgccggacgcgcgccagatgtacgagctg
gcgcagcgcgcctggcaccccgacgccgacgcgttgctgatcagctgcctgaacatgcac
gcccaggaagtcgtcggcctgctggaacagcagctgggccgcccggtcatcacctccacc
accgccacgctctggaaactgttgcgcagcgcgggccgcgcagaccggataccgggctat
ggccgcttgctggccgagcactga

DBGET integrated database retrieval system