KEGG   Bordetella parapertussis 12822: BPP0573Help
Entry
BPP0573           CDS       T00140                                 

Definition
hypothetical protein
Orthology
K01799  
maleate isomerase [EC:5.2.1.1]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpa00650]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bpa00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(606409..607212)
Genome map
AA seq 267 aa AA seqDB search
MLTAMNTPAHTLMPYDAALRSFPGLLRAPEAARTRLGVILPSVNTVVEPWFGQAVAADVR
VHATRMLLASEVTAEALRRMDHEEGLDAARRIASCRPDAIAYCCTASSIVQGLDYDRRLR
QSLEEATGKPCFTAVGAIIEALQACNARKIAIASPYTDAIDHAEKAFFEEAGFQVLNAAN
LNIAESFALAAPDARQMYELAQRAWHPDADALLISCLNMHAQEVVGLLEQQLGRPVITST
TATLWKLLRSAGRADRIPGYGRLLAEH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccgccatgaacacgccggcccacacattgatgccctacgacgcggcgctgcgc
agcttccccgggctgctgcgcgcgcccgaggcggcgcgcacgcggcttggagtgatcctg
cccagcgtcaataccgtggtcgagccctggttcggccaggccgtcgcggccgacgtccgc
gtgcacgcgacccgcatgctgctggccagcgaagtcacggccgaagcgctgcggcgcatg
gaccacgaggaagggctcgacgcggcgcggcgcatcgccagctgccgtccggacgcgatt
gcctactgctgcacggcttccagcatcgtccaggggctggattacgaccggcgcctgcgg
caatcgctcgaggaagcgaccggcaagccgtgcttcacggccgtcggggcgatcatcgag
gcattgcaggcatgcaacgcgcgcaagatcgccatcgcctctccgtataccgacgcgatc
gatcatgccgaaaaggcattcttcgaggaagcgggcttccaggtgttgaacgccgccaac
ctgaacatcgccgaatcgttcgcgctggcggcgccggacgcgcgccagatgtacgagctg
gcgcagcgcgcctggcaccccgacgccgacgcgttgctgatcagctgcctgaacatgcac
gcccaggaagtcgtcggcctgctggaacagcagctgggccgcccggtcatcacctccacc
accgccacgctctggaaactgttgcgcagcgcgggccgcgcagaccggataccgggctat
ggccgcttgctggccgagcactga

DBGET integrated database retrieval system