KEGG   Bordetella parapertussis 12822: BPP0800Help
Entry
BPP0800           CDS       T00140                                 

Gene name
pgm
Definition
phosphoglucomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP0800 (pgm)
   00030 Pentose phosphate pathway
    BPP0800 (pgm)
   00051 Fructose and mannose metabolism
    BPP0800 (pgm)
   00052 Galactose metabolism
    BPP0800 (pgm)
   00500 Starch and sucrose metabolism
    BPP0800 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BPP0800 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    BPP0800 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPP0800 (pgm)
Enzymes [BR:bpa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BPP0800 (pgm)
    5.4.2.8  phosphomannomutase
     BPP0800 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(858357..859739)
Genome map
AA seq 460 aa AA seqDB search
MAHPFPASVYKAYDIRGSVPDQLDPVFARALGRALAASARAQGIGALVVGRDGRLSSPDL
AGALQEGIMEGGVDTLDIGQVPTPLVYFAAHTQGTGSGVAVTGSHNPPQYNGFKMMMGGQ
ALYGPAVQALRPAMLAPAAAPGTWGERRQLDVVPAYIERIVSDVKLARPMKIAVDCGNGV
AGALAPQLFRALGCEVDELYCEVDGTFPNHHPDPAEPRNLQDLIAHVTSTDCELGLAFDG
DGDRLGVVTKSGQIIWPDRQLILFARDVLARCPGATIIYDVKCSRHVGVAIEQSGGVPLM
WQTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGLYTGARLLEIVSRETDASRPL
EALPQALSTPELKLEMAEGEPHALIVALQQQGEFASASRLVTIDGVRAEYPDGFGLARAS
NTTPVVVLRFEAETQPGLARIQQEFRQQLLRLAPQAKLPF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcacccctttcccgcatcggtctacaaggcgtacgacatccgtggctcggttccc
gaccagctcgacccggtattcgcccgggcgctgggccgtgccctggccgccagcgcccgc
gcgcagggcatcggcgccctggtggtcggccgcgacggccgcctgagcagccccgacctg
gccggcgcgctgcaggaaggcatcatggaaggcggtgtggataccctggatatcggccag
gtgcccacgccgctggtctatttcgcggcgcacacccagggcacgggctcgggcgtggcg
gtcaccggcagccacaacccgccgcagtacaacggcttcaagatgatgatgggcggccag
gccctgtacggcccggccgtgcaggcgctgcgcccggccatgctggcgccggctgcggcg
ccgggcacctggggcgaacgccgccagctcgatgtcgtccccgcctatatcgagcgcatc
gtgtcggacgtgaagctggcgcgccccatgaagatcgccgtcgactgcggcaatggcgtg
gccggcgccctggcgccgcaattgttccgcgcgctgggctgcgaagtggacgaactctat
tgcgaggtcgacggcacgtttcccaaccaccatcccgacccagccgaaccgcgcaacctg
caggacctgatcgcccatgtcaccagcaccgactgcgagctgggcctggccttcgacggc
gacggcgaccgcctgggcgtggtgaccaagtccggccagatcatctggcccgaccgccag
ctgatcctgttcgcccgcgacgtgctggcccgctgccccggcgcgaccatcatctatgac
gtcaagtgcagccggcacgtgggcgtggccatcgagcaaagcggcggcgtgccgctgatg
tggcagaccggccattcgctggtgaaggccaagctggccgagaccggcgcgccgctggcc
ggcgagatgagcggccatatcttcttcaaggagcgctggtacggcttcgacgacggcctg
tacaccggcgcccgcctgctggaaatcgtctcccgcgaaaccgatgcgtcgcgcccgctg
gaggccctgccgcaggcgctgtcgacccccgagctcaagctggaaatggccgagggcgag
ccgcatgcgctgatcgtcgccctgcagcagcagggcgagttcgccagcgccagccggctg
gttacgatagacggcgtgcgcgcggaatacccggacggcttcgggctggcgcgcgcctcc
aataccacccccgtcgtcgtgctgcgcttcgaggcggagacccagccgggcctggcccgc
atccagcaggaattccgccagcagctgctgcggctggctccgcaagccaaactgcccttc
tga

DBGET integrated database retrieval system