KEGG   Bordetella parapertussis 12822: BPP1223Help
Entry
BPP1223           CDS       T00140                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpa  Bordetella parapertussis 12822
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPP1223 (recR)
DNA repair and recombination proteins [BR:bpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BPP1223 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1304135..1304785
Genome map
AA seq 216 aa AA seqDB search
MAARRAAGRAAVCAMDPQLPEPEPLIALIEALRRLPGVGVRSARRMAYHLLQHDLQGADM
LGRALSGAVQHLRHCARCNSFTEDEVCATCANPKRDPGLLCIVETPADQNMIESSHGYRG
LYYVLMGRIAPLEGVGPRELDFQRVIERACDGVVQEVILATNFTAEGETTAHFLGDALSE
RGLKVTRLARGVPAGSELEYVDAGTIAWALMERRST
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttggcggcccgccgggccgccgggcgcgctgctgtctgcgcgatggatccccaactcccc
gaacccgaaccgctgatcgccctgatcgaggcgttgcgccgcctgcctggcgtgggcgtg
cgctcggcccgccgcatggcctatcacctgctgcagcacgacctgcagggggccgacatg
ctgggccgcgcgctttccggcgccgtgcagcacctgcgccattgcgcgcgctgcaacagc
tttaccgaagacgaggtctgcgcgacctgtgccaatcccaagcgcgatcccggcctgctg
tgcatcgtcgagacgccggcggaccagaacatgatcgagtccagccacggctaccgcggg
ctgtactacgtgctgatgggacgcatcgcgccgctggaaggggtgggaccgcgcgagctc
gacttccagcgcgtcatcgagcgcgcctgcgacggcgtggtccaggaagtcatcctggcc
accaatttcaccgccgagggcgagacgacggcccacttcctgggcgatgccctgagcgag
cgcggcctgaaagtcacccggctggcgcgcggcgtgccggccggcagcgagctcgagtat
gtcgatgccggcaccattgcctgggccttgatggagcgccgttcgacctag

DBGET integrated database retrieval system