KEGG   Bordetella parapertussis 12822: BPP1769Help
Entry
BPP1769           CDS       T00140                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPP1769 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BPP1769 (aceA)
Enzymes [BR:bpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BPP1769 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1896056..1897378
Genome map
AA seq 440 aa AA seqDB search
MSNRETEIRNLQKDWAENTRWQGIKRAYSAEDVIRLRGSVAVEHSLARRGATRLWDSLHS
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVR
RINNALARCDQIQWMEGKNPGDQDYIDYYAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVSKLVSARLAADVMGTPTILLARTDADAADLVT
SDVDENDRPFITGERTVEGFFRTRAGLDQAISRGLAYAPYADLIWCETSTPNLEYARKFA
EAVHRQFPGKLLAYNCSPSFNWKKNLDDGTIAKFQRELGAMGYKFQFITLAGFHALNYGM
FELAHGYARRQMSAFVELQQKEFAAAELGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTA
LTGSTEEAQFEHGGQAVKAA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcgaaaccgaaatccgcaacttgcagaaagactgggccgagaacacccgc
tggcagggcatcaagcgcgcctacagcgccgaggatgtgatccgcctgcgcggctcggtg
gccgtcgagcattcgctggcgcgccgcggcgcgacccgcttgtgggattcgttgcatagc
gagcccttcgtcaattcgctgggcgcgttgaccggcaaccaggccatgcagcaggtcaag
gccggcctgaaggccatctacctgtccggctggcaggtggccggcgacgccaacctggcc
ggcgagatgtacccggaccagtcgctgtaccccgccaactcggtgccgcaggtggtgcgc
cggatcaacaacgccctggcgcgttgcgaccagatccagtggatggaaggcaagaacccg
ggcgaccaggactacatcgattactacgcgcccatcgtggccgatgccgaggccggtttc
ggcggcgtgctcaacgccttcgaactgatgaaggccatgatcgaggcgggcgcggccggc
gtgcacttcgaagaccagctggcttcggtgaagaagtgcggccacatgggcggcaaggtg
ctggtgccgacccgcgaggccgtgtccaagctggtctcggcccgcctggccgccgacgtg
atgggcacgcccaccatcctgctggcccgcaccgacgccgacgcggccgacctggtgacc
agcgacgtggatgagaacgatcgcccgttcatcaccggcgagcgcacggtggaaggcttc
ttccgcacccgcgccggcctggaccaggcgatttcgcgcggcctggcctacgcgccgtat
gccgacctgatctggtgcgaaacctccacgcccaacctggagtatgcgcgcaagttcgcc
gaggccgtccatcgccagttcccgggcaagctgctggcgtacaactgctcgccctcgttc
aactggaagaagaacctggacgacggcacgatcgccaagttccagcgcgaactcggtgcg
atgggctacaagttccagttcatcacgctggccggtttccacgcgctgaactacggcatg
ttcgaactggctcacggttacgcgcgccgccagatgagcgctttcgtggagctgcagcag
aaggaattcgccgccgccgagctgggctttaccgcggtcaagcaccagcgcgaagtcggc
accggctacttcgacgccgtgacccagacgatcgaaggcggccagtcctcgaccacggcc
ctgaccggctcgaccgaggaagcgcagttcgagcacggcgggcaggccgtcaaggcggcg
tga

DBGET integrated database retrieval system