KEGG   Bordetella parapertussis 12822: BPP1994Help
Entry
BPP1994           CDS       T00140                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPP1994 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BPP1994 (dapE)
Enzymes [BR:bpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BPP1994 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2134540..2135679)
Genome map
AA seq 379 aa AA seqDB search
MTASAVLDLVKDLIARPSVTPDDVDCQMLLAQRLERIGFQCETIARGGVTNLWARRGAGA
PLTVFAGHTDVVPPGPRDKWDSDPFVPTERDGFLYGRGAADMKSSIAAFVVAAEEFVAAH
PEHPGSIALLITSDEEGPAVDGTVIVCDELRQRGEQLDYCIVGEPTSTEALGDVCKNGRR
GSLSGRLLVKGVQGHVAYPHLARNPVHQLAPALTELVAIEWDQGNEYFPPTTFQVSNLHA
GTGATNVVPGEAVALFNFRFSTASTPDQLKARVHEVLDRHGLEYQLDWELGGEPFLTPRG
SLTDALVSAIQAETGLQAELSTTGGTSDGRFIARICPQVIEFGPCNATIHKVNERIELSS
LAPLKNIYRRTLENLLLAD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatctgccgtactggatctggtcaaggatctgatcgcccgtccctcggtcacg
cccgacgatgtggattgccagatgctgctggcgcagcgcctggagcgcatcggtttccaa
tgcgaaacgattgcgcgcggcggcgtgaccaacctgtgggcgcgacgcggcgccggcgcg
cccctgacggtgttcgccggccataccgacgtggtgccgcccggtccgcgcgacaagtgg
gacagcgaccccttcgtgccgaccgagcgcgacgggttcctgtacggcaggggtgccgcc
gacatgaaaagctcgatcgccgccttcgtggtggcggccgaggagttcgtggcggcgcac
cccgaacacccgggttcgatcgccctgctgatcacctccgacgaagaggggccggcagtc
gacggaacggtgatcgtctgcgacgagctgcgccagcgcggcgaacagctcgactactgc
atcgtcggcgaaccgacctccaccgaggcgttgggcgacgtatgcaagaacggacgccgc
ggttcgctgtccgggcgcctgctggtcaagggcgtgcaaggccatgtcgcgtacccccac
ctggcgcgcaacccggtccatcaactggcgccggcgctgaccgaactggtcgccatcgaa
tgggaccagggcaacgagtacttcccgcccaccacgttccaggtctccaacctgcacgcc
ggcacgggcgcgaccaacgtcgtgccgggcgaggcggtggcgctgttcaatttccgcttt
tccaccgccagcacgcccgaccagctcaaggcgcgcgtgcatgaggtgctggaccgccac
ggcctggagtaccagctcgactgggagctgggcggcgaacctttcctgacgccgcgcggc
tcgctgaccgatgcgctggtgtcggcaatccaggccgaaaccggattgcaggccgaactc
tcgaccaccggcggcacatccgatggccgcttcatcgccaggatctgcccgcaggtcatc
gagttcggcccctgcaacgccacgatccacaaggtcaacgagcgcatcgaactgtccagc
ctcgcgcccttgaagaacatttaccgccgcacgctggaaaacctgctgctggccgactga

DBGET integrated database retrieval system