KEGG   Bordetella parapertussis 12822: BPP2028Help
Entry
BPP2028           CDS       T00140                                 

Gene name
iscS
Definition
cysteine desulfurase (EC:4.4.1.-)
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BPP2028 (iscS)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    BPP2028 (iscS)
Enzymes [BR:bpa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BPP2028 (iscS)
Transfer RNA biogenesis [BR:bpa03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    BPP2028 (iscS)
 Prokaryotic Type
    BPP2028 (iscS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2169019..2170230
Genome map
AA seq 403 aa AA seqDB search
MSNRPIYLDYSATTPVDPRVVEKMIPWLYESFGNPASRSHAFGWEAEDAVEKAREEVAKL
VNADPREIVWTSGATESDNLAIKGAANFYAERGKHIITVKTEHKAVLDTCRELERQGFEV
TYLDVQDDGLLSLDAFKAALRPDTILVSVMMVNNEIGVIQDIAALGEICREKGIIFHVDA
AQATGKVEIDLQKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEAQMHGGGHERGFRS
GTLATHQIVGMGEAFRLAREEMGTENERVRMLRDRLLAGLTQIEEVYVNGSMEHRVPHNL
NISFNYVEGESLIMAIKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTLGRFT
TEQEIDFTIELIKSRVGKLRDMSPLWEMAQEGIDLNSVQWAAH
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgccccatctacctggactactcggctaccacgccggtcgacccgcgcgtg
gtcgagaaaatgattccctggttgtacgagagtttcggcaatccggcctcgcgcagccac
gcctttggctgggaagccgaggacgcggtcgagaaggctcgcgaggaagtcgccaagctg
gtcaacgccgatccgcgcgagatcgtctggacttccggcgccaccgagtcggacaacctg
gccatcaagggcgcggcgaatttctatgccgagcgcggcaagcacatcattaccgtcaag
accgaacacaaggcggtgctggatacctgtcgggagctcgaacgccagggctttgaagtg
acctacctggatgtccaggacgatggtctgctcagcctcgatgcgttcaaggccgcgctg
cgtccggataccatcctggtgtcggtgatgatggtcaacaacgagatcggcgtcatccag
gacatcgccgcgctgggcgagatctgccgcgagaagggcatcatcttccacgtggacgcg
gcccaggccaccggcaaggtcgagatcgacctgcagaagctgaaggtggacctgatgtcg
ttctcggcgcacaagacgtacggccccaagggcatcggcgcgctgtatgtgcggcgcaag
ccgcgcgtgcgcatcgaggcgcagatgcacggcggcggccacgagcggggcttccgctcg
ggcacgctggccacgcaccagatcgtcggcatgggcgaggcgttccgcctggcgcgcgag
gaaatgggcaccgagaacgagcgcgtgcgcatgctgcgcgaccgcctgctggccggcctg
acgcagatcgaggaagtgtatgtgaacggcagcatggagcaccgcgtgccgcacaacctg
aacatcagcttcaactatgtcgagggcgagtccctgatcatggcgatcaaggagctggcc
gtctccagcggttcggcctgcacgtcggccagcctggagccgtcctatgtgctgcgcgcg
ctgggccgcaacgacgagctggcgcacagctccatccgcttcaccctgggccgcttcacg
accgaacaggaaatcgacttcacgatcgaactgatcaagagtcgtgtcggcaagctgcgc
gatatgtcgccgttgtgggaaatggcccaggaaggcattgatctgaattccgtgcagtgg
gccgcgcactga

DBGET integrated database retrieval system