KEGG   Bordetella parapertussis 12822: BPP2389Help
Entry
BPP2389           CDS       T00140                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bpa  Bordetella parapertussis 12822
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bpa00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2552260..2552670
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAASAAARAAAPDPVRGEQVYARCLACHALAYDRVGPRHCGLLGR
KAGSVPGFAYTQAMEDSGLTWDATTLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggctgcgtcggcg
gccgcgcgggccgcagcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctggcctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggcttcgcctatacgcaagccatggaagactccggcctgacc
tgggacgccaccacgctcgaccgcttcctggccgatcccttgaagacggtgccaggcacc
gccatgacttacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccgcattag

DBGET integrated database retrieval system