KEGG   Bordetella parapertussis 12822: BPP2480Help
Entry
BPP2480           CDS       T00140                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPP2480 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPP2480 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BPP2480 (thrC)
Enzymes [BR:bpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BPP2480 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2658050..2659456
Genome map
AA seq 468 aa AA seqDB search
MKYISTRGGMAPQSFSDILLEGLAPDGGLAIPEQLPQVDAATLESWRGLSYADLAFEVLS
LFATDIPAEDLRGLTRAAYRQGVFKSEDIVPVRELGQGLQLLGLSEGPTLAFKDMAMQFL
GQVFEYVLTRRGTTLNIVGATSGDTGSAAEYALRGKQGVAVFMLSPHGRMSAFQRAQMYS
LQDENIHNIAVRGVFDQAQDIVKQLAGDLAFKTRYRLGAVNSINWARIAAQVVYYFHGWL
RAAPKGGEVSFAVPSGNFGNILSGHIARGMGVPIRRLVLATNENNVLEEFFRTGVYRPRG
PERTYATSSPSMDISRASNFERFVFDLVGRDPGRVASLWADLARDGSFDLSALKPQFETR
YGFVAGASSHADRLQTIRNTFDETGVLVDPHTADGIKVARQFVEPGVPMLVLETALPAKF
AETIEAALGRTVPPPADLADLESLPQRVTLMDCDAQAVRAFIEAHAKV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatctcgacccgcggcggcatggccccgcagagtttctccgatatcctgctc
gaaggcctggcgcccgacggcgggctggccatccccgagcagctgccgcaagtcgacgcg
gccacgctggagtcctggcgcgggctctcgtacgccgacctggccttcgaagtgctgtcg
ctgttcgccaccgacatcccggccgaggacctgcgcgggctgacgcgcgcagcctaccgg
cagggcgtgttcaagagcgaagacatcgtcccggtgcgcgagctggggcaggggttgcag
ctgctgggcctgtccgaggggcccacgctggccttcaaggacatggcgatgcagtttctc
ggccaggtcttcgagtacgtcctgacgcggcgcggcaccacgctgaacatcgtcggcgcc
acctccggcgataccgggtcggcggccgagtacgcgctgcgcggcaagcagggcgtggcc
gtgttcatgctgtcgccgcacggccgcatgagcgcattccagcgcgcccagatgtactcg
ttgcaggatgagaacatccacaatatcgcggtgcggggcgtgttcgaccaggcgcaggac
atcgtcaagcagctggccggcgacctggcgttcaagacgcgctatcgcctgggcgcggtc
aactcgatcaactgggcgcgcatcgccgcccaggtggtgtactacttccacggctggctg
cgtgccgcgcccaagggtggcgaggtgtcgttcgcggtgccttcgggcaacttcggcaac
atcctgtccgggcacatcgcgcgcggcatgggcgtgccgatccgccgcctggtgctggcc
accaacgagaacaacgttctcgaggagttcttccgcaccggcgtttaccgcccgcgcggt
cccgagcgcacctacgccacctccagcccgtcgatggacatctcgcgcgcctcgaacttc
gagcgcttcgtgttcgacctggtcgggcgcgaccccggccgcgtggcgtcgctgtgggcc
gacctggcgcgcgacggcagcttcgacctgtcggcgctcaagccgcagttcgaaacccgc
tacgggttcgtggccggcgccagctcgcacgccgaccgcctgcagaccatacgcaatacc
ttcgacgaaaccggcgtgctggtcgacccgcacacggccgatggcatcaaggtggcgcgc
cagttcgtcgagccgggcgtgcccatgctggtgctcgagacggccctgccggccaagttc
gcggaaaccatcgaggcggcgctcgggcgcaccgtgccgccgccggctgacctggccgac
ctcgaatcgctgccccagcgcgtgacgctcatggactgcgacgcgcaggcggtgcgggcc
ttcatcgaggcccacgccaaagtgtaa

DBGET integrated database retrieval system