KEGG   Bordetella parapertussis 12822: BPP2617Help
Entry
BPP2617           CDS       T00140                                 

Gene name
pyrB
Definition
(GenBank) aspartate transcarbamoylase (EC:2.1.3.2)
  KO
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BPP2617 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPP2617 (pyrB)
Enzymes [BR:bpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BPP2617 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
2814666..2815985
Genome map
AA seq 439 aa AA seqDB search
MHSFLGPPMSISQQAFLRDAMRRLNLTRDVFAGRIGVKRRALDTWLLPEGSQEFRAMPEV
VERFVSEIVQNRDLLEKYTQSGQVGPLRDRIAVEGRHQLLSVDQFTRESVEDLFRVADMM
QPIARRQKVSRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGES
IYDTSRVMSGYVDAMVIRHPEQGSVAEFAQATNIPVVNGGDGPGEHPSQALLDLYTILTE
FSRLGKLLDGAHIAMVGDLKYGRTVHSLIKLLALYKGVKFTLISPQGLEMPDYIVEQASR
NGNVIEQKSTLAEGLAGADVIYATRVQKERFANEEAGEGYTADFQVSRAIIDAYCGPDTI
VMHPLPRDSRPGSNDLSTDLNHDPRLAIFRQTDNGIPIRMAIFAVLLGVEGLVQHSMRDV
TWQHPSHIGPDDSVFHGLD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgcattccttcctggggccgcccatgtccatttcccaacaagcctttctgcgcgacgcg
atgcgtcgcctcaacctgacgcgcgacgtgttcgccggccgcatcggcgtcaaacgccgc
gcgctggatacgtggctgttgcccgaagggtcgcaggaatttcgcgcgatgcccgaagtg
gtagagcgctttgtcagcgaaatcgtgcagaaccgcgacttgctggagaaatatacgcag
agcgggcaggtgggccccttgcgcgaccgcattgccgtcgaagggcgtcatcagctgctg
tcggtcgaccagttcacccgcgaatcggtggaagacctgttccgcgtggcggacatgatg
caacccattgcgcgccgccagaaggtgtcgcgggtgctggaaggcgcggtgctgggcaac
ctgttcttcgaggccagcacgcggactcgcgtcagcttcggcgcggcgttctgccgcctg
ggcggctcggtctgcgacaccacgggcttcacgttctcgtccatggccaagggcgagtcc
atctacgatacgagccgcgtgatgagcggctacgtggacgccatggtcatccgccatccc
gagcaggggtcggtggcggagttcgcccaggcgaccaatatcccggtggtcaatggcggc
gacggcccgggcgagcatcccagccaggccctgctggatctgtacaccatccttaccgag
ttctcgcgcctgggcaagctgctcgacggcgcgcacatcgccatggtcggcgacctgaag
tacggccgcacggtgcactcgctgatcaagctgctggcgttgtacaagggcgtgaagttc
acgctgatctcgccgcaggggctggagatgcccgactacatcgtcgagcaggccagccgc
aacggcaatgtgatcgagcagaaaagcacgctggccgagggcctggcgggcgcggacgtc
atttacgccacgcgtgtgcagaaagagcgcttcgccaacgaagaggcgggcgaaggctat
acggcggacttccaggtcagccgcgccatcatcgacgcctactgcggtccggataccatc
gtcatgcaccccttgccgcgcgacagccggccggggtccaacgatctgagcacggatctg
aaccacgacccgcgcctggcgattttccgccagaccgacaatggcattccgatccggatg
gcgatcttcgcggtgctgctgggcgtggaagggctggtgcagcattcgatgcgcgacgtg
acgtggcagcatccgtcgcacatcggccccgacgactcggtattccacggcctggactag

DBGET integrated database retrieval system