KEGG   Bordetella parapertussis 12822: BPP2643Help
Entry
BPP2643           CDS       T00140                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPP2643
Enzymes [BR:bpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPP2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2842810..2843634
Genome map
AA seq 274 aa AA seqDB search
MTGRSGPRGGLPMSQIAILTRPQGRNGALAQRLHEAGWQTLCLPALRIEPLPPENGAVPL
PRDYDLVVFVSGNAARLYLEQLGERGQLPWPAGAVAATVGPASARALLDSGQFGADTTVL
HPAETALTHDSEALWALLRARPALPRRALLVRGTQGRDWLADRLAAAGVEVSRHAVYRRR
PAPWAQEGRQRLRDWARAGERPTWLLTSGEGIDALVQGLREEQLLDWWLQGRFVVTHPVL
AERLRALAGGGADAPMVKNCMPADEAIFATFVAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgacagggcggtcgggccctcgcgggggcttgcctatgtcgcagattgccatcctgaca
cggccgcaaggccgcaatggcgcgcttgcgcaacgcctgcacgaggccggctggcagacc
ctttgcctgccggccttgcgcatcgagccgttgccgcccgaaaatggcgcggtgccgctg
ccgcgcgactacgacctggtggtgtttgtcagcggcaacgcggcgcgcctgtacctggag
cagctgggggagcgggggcaattgccatggccggcaggcgcggtcgccgccaccgtgggc
ccggccagcgcccgcgccctgctggattcgggccagtttggcgccgatacaacagttttg
caccctgcggaaaccgcgctcacccacgattcggaagccttgtgggccttgttgcgggcg
cgcccggcattgccgcgccgcgcgctgctggtgcgcggcacccaagggcgcgactggctg
gccgatcgcctggccgcggctggcgtggaggtcagccgccacgcggtctaccgccggcgg
cccgcgccctgggcgcaggaggggcgccagcgcctgcgcgactgggcccgggcgggcgag
cgcccgacctggctgctcaccagcggcgagggcatcgacgcgctggttcagggcctgcgc
gaggagcaattgctggactggtggctgcaaggccgtttcgtcgtcacgcaccccgtgctg
gccgagcggctgcgggcgctggccggtggcggggccgatgcgccaatggtaaaaaactgc
atgcctgccgatgaggcgatcttcgcgacttttgttgcggcttga

DBGET integrated database retrieval system