KEGG   Bordetella parapertussis 12822: BPP2723Help
Entry
BPP2723           CDS       T00140                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BPP2723
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP2723
  Lipid metabolism
   00071 Fatty acid degradation
    BPP2723
  Amino acid metabolism
   00350 Tyrosine metabolism
    BPP2723
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BPP2723
   00626 Naphthalene degradation
    BPP2723
Enzymes [BR:bpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BPP2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2918012..2919166)
Genome map
AA seq 384 aa AA seqDB search
MNGFEFRTHARTLAGEGTSQRLGEAVAAQWGPCRILVVTDEQLVRLGLVAALAQSLRDAG
HTVQVYDGVLADPPEAVVSQAIARGRETDVQCVIGFGGGSSMDIAKLVAAFAGSAADFRD
SYGIDRVATARLPLVQVPTTAGTGSEATPIAIVTREDASKAGIVSPVLYCDIAVLDAALT
RGLPPAVTAATGIDAIVHAVEAYTSRLRKNPISDGLARQALRLLCRSIGPACRDGADMAA
RHDMLLGAMLAGQAFANAPVAAVHALAYPLGGVFHVPHGLSNALMFGAVLRFNLPQAGAA
YAQLAQIACPQVDGPQQARAEGFVQEMASLGPRLGLPRRLAEVGVAERDLPMLAQQAMQQ
QRLLVNNPRELGYDDALRLYREAL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacggattcgagtttcggacacatgcccgcacgctggcgggcgaggggacctcgcaa
cggttgggcgaggcggtcgcggcgcaatgggggccgtgccgcatcctggtcgtcacggac
gagcagctggtgcggctgggtctggtcgcggccctggcgcaaagcctgcgcgacgccggt
cacacggtccaggtctacgacggcgtgctggccgatccgcccgaagcggtggtgagccag
gcgatcgcgcggggccgggaaacggacgtgcaatgcgtgatcggcttcggcggcggctcg
tcgatggatatcgcgaaactggtggcggcgttcgccggctccgcggccgactttcgcgac
agctacggcatcgaccgcgtcgccacggcgcgcctgccgctggtgcaggtgccgaccacg
gccggcaccggctcggaagccacgcccatcgccatcgtgacccgcgaggacgcctccaag
gcgggcattgtctcccccgtcctgtactgcgacatcgccgtactggatgccgcgttgacc
cggggcctgccgccggccgtgaccgccgccaccggcatcgacgccatcgtgcacgccgtc
gaggcctataccagccggctgcgcaagaacccgatctccgatggcctggcgcgccaggcg
ttgcgcctgctgtgccgttccatcggccccgcatgccgcgacggcgccgacatggcggcc
cgccatgacatgttgctgggcgcgatgctggcggggcaggcgttcgccaatgcgccggtg
gcggccgtgcatgcgctggcctatccgctgggcggcgttttccacgtgccgcacggcctg
tccaatgcattgatgttcggcgcggtgctgcgtttcaacctgccgcaggccggcgccgcc
tatgcccagcttgcgcagatcgcttgtccgcaggtggacggcccgcagcaggcgcgcgcc
gaaggattcgtgcaggaaatggccagcctggggccgcgtctggggctgccgcggcgcctg
gccgaagtcggggtggccgaacgcgatctgcccatgctcgcgcaacaggccatgcagcaa
cagcgtttgctggtcaacaaccccagggagctcggctacgacgacgccttgcgcctttac
cgggaggcgctgtga

DBGET integrated database retrieval system