KEGG   Bordetella parapertussis 12822: BPP2778Help
Entry
BPP2778           CDS       T00140                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BPP2778
Enzymes [BR:bpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BPP2778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2977441..2978424
Genome map
AA seq 327 aa AA seqDB search
MPSPSALHDLCDTPPTFMGVPHRHAIDGARAAILGIPFDCGTHAFRIGARQGPQSIREQS
RLMRTFNPELADYNPLQRLGVIDCGNVRVVPSDILDAFERIEQAVGAIVDGGAVPVTMGG
DGSVSLPQLRAVGKRHPGLAVIHLDSHTDTNTFVKGKEYNAGTQFTHAALEGRVDTSLAF
HIGTRGTTFTQHVFRHARHFGYQIIPLNELLARGMAEVLQDLRARLGERPVYLCLDMDVL
DPSCAPGVCAPSWGGLSAREAIAFLRGLAGLNIVAIDVNTVSPPHDVNGTTASLAAALMV
EGLVLLCKRLGLDHPDPAPDFAAMYAR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccatcccccagcgcgctgcatgacctgtgcgacacgccacctaccttcatgggcgtg
ccccatcgccatgccatcgacggcgccagggcggccatcctcggcatccccttcgattgc
ggcacgcacgcgtttcgcatcggcgcgcgccagggtccgcagtcgatccgcgaacagtcg
cgcctgatgcgcaccttcaaccccgaactggccgactacaacccgctgcagcggctcggg
gtgatcgactgcggcaacgtgcgcgtggtgcccagcgacattctcgatgccttcgagcgc
atcgagcaggcggtcggcgccatcgtcgatggcggtgcggtgccggtcaccatgggcggc
gacggcagcgtgtcgctgccgcaactgcgcgcggtcggcaaacgccatccgggcctggcc
gtcatccacctcgactcgcacaccgacaccaacaccttcgtcaagggcaaggaatacaac
gccggcacgcagttcacgcacgccgccctggaaggccgcgtggacacctcgctggcgttt
catatcggcacgcgcggcaccaccttcacccagcatgtgttccgccatgcgcgccacttc
ggctaccagatcatcccgctcaacgagctgctggcgcgcggcatggccgaagtgctgcag
gacctgcgcgcgcgcctgggcgaacggccggtctacctgtgcctggacatggacgtgctg
gatccgtcctgcgcgcccggggtatgcgcgcccagctggggcggcctgagcgcgcgcgag
gcgatcgcgttcctgcgcgggctggccggcctgaacatcgtcgccatcgacgtcaatacg
gtcagcccgccgcacgacgtcaatgggaccacggcatcgctggcggccgcgctgatggtc
gaaggcctggtgctgctgtgcaagcgcctggggctggaccatcccgacccggcgcccgac
ttcgccgccatgtacgcgcgctga

DBGET integrated database retrieval system