KEGG   Bordetella parapertussis 12822: BPP2892Help
Entry
BPP2892           CDS       T00140                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3103180..3105375
Genome map
AA seq 731 aa AA seqDB search
MMRDSPSIQGTLDAATQHALLAGRHADPFSVLGPHQAGAHTVVRVLAPGARTVMAVLPGG
QRTPLLPMQPGLFENTVPGLQPGAPAAYRLCIEWEGGIQHTADPYAFGPVLDTAQLDHCA
AGGWRYLAGLLGAHAASVDGCAGTRFALWAPNARRVAVVGDFNGWDGRRHAMRLRYPAGV
WELFLPDVGPGARYKFQVLGADGHTVLKADPLARQAEAPPATASIVPDERPFAWTDEAWM
EQRAARQRCDAPISIYEVHAGSWFDDAGAPRWQSLAARLPEYARSLGFTHIELLPVMAHP
FGGSWGYQPLGLFAPAAAHGAPADFAHFVDRCHEAGLGVILDWVPAHFPDDAHGLARLDG
TPLYEHADPHEGRHPDWNTLIYNYGRREVRAFLIASAIHWLRHYHVDGLRVDAVASMLYR
DYSRPAGQWIPNRHGGRENLEAIDFLRELNAAVGVQCPGAITVAEESTAWPGVTAPVANG
GLGFDYKWNMGWMHDTLRYMRRDPIHRRHHHHDLSFGMVYAYAERFVLPLSHDEVVHGKG
SLLGKMPGERAAQLAQLRLYYAFMWAHPGKKLLFMGGEFGQQGEWNHDAMLQWSLLDDPA
HRGLQRLVADLNHVYATLPELHCRDADPSGFAWIVGDDADNSVLAFARVDASHCLVAVCN
FTPVPRPGYRFGVPHAGDWRVRVDTGATRYGGAGGGPPICLRSEPIPAHGHPQSLVLDLP
GFTALYLRHSE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgagattcgccttccatccagggcacgctggacgcggccacccagcacgcgctg
ctggccggccgccatgccgatccgttttccgtgctggggccgcaccaggccggcgcgcat
accgtggtgcgcgtgctggcgcccggcgcgcgcaccgtgatggccgtgctgcccggcggc
cagcgcacacccttgctgcccatgcagcccggcctgttcgaaaacaccgtgccgggcctg
cagccgggcgcgccggcagcctaccgactgtgcatcgaatgggagggaggcatccagcac
accgccgacccctacgcattcgggccggtgctcgacaccgcccagctcgaccattgcgcg
gccggcggctggcgctacctggccggcctgctgggcgcgcacgccgccagcgtggacggc
tgcgcgggcacccgcttcgcgctatgggcgcccaatgctcggcgcgtggcggtggtgggc
gatttcaacggctgggatggccggcgccacgccatgcgcctgcgctatccggcgggcgtc
tgggagctgttcctgcccgacgtggggccgggcgcgcgctacaaattccaggtgctgggc
gccgacggccataccgtgctcaaggccgacccgctggcgcgccaggccgaggcgccgcct
gccaccgcgtccatcgtccccgacgaacgccccttcgcgtggaccgacgaggcctggatg
gaacaacgcgcggcgcgccagcgttgcgacgcgccgatctccatctacgaagtgcatgcc
ggctcctggttcgacgacgccggcgcgccgcgctggcaaagcctggccgcccgcctgccc
gaatacgcgcgctcgctgggcttcacccatatcgagctgctgcccgtgatggcgcatccc
ttcggcggttcgtggggctaccagccgctcggactgttcgcgccggcggccgcgcacggc
gcgccggccgacttcgcgcatttcgtcgaccgttgccacgaggccgggctgggcgtcatc
ctggactgggttccggcccacttccccgacgacgcgcacgggctggcgcgcctggacggc
acgccgctctacgagcacgccgacccgcacgaaggccgccatcccgactggaacacgctg
atctacaactacggccgccgcgaggtgcgggcctttctcatcgccagcgccatccactgg
ctgcgccattaccatgtagacgggctgcgcgtggacgcggtcgcgtccatgctgtatcgc
gactacagccgcccggccggccagtggatccccaaccgccacggcgggcgcgagaatctc
gaagccatcgacttcctgcgcgaactcaacgccgccgtgggcgtccagtgccccggcgcc
atcaccgtggccgaggagtccaccgcctggcccggcgtgaccgcgccagtggccaacggc
ggtctgggcttcgactacaagtggaacatgggctggatgcacgacacgctgcgctacatg
cggcgcgatccgatccatcgccgccatcaccaccacgatctcagcttcggcatggtctat
gcctatgccgaacgcttcgtgctgccgctctcgcatgacgaagtggtgcacggcaagggc
tcgctgctgggcaagatgccgggcgagcgggccgcccagctggcccagttgcggctgtac
tacgccttcatgtgggcccatcccggcaagaagctgctgttcatgggcggcgagttcggc
cagcaaggcgagtggaaccacgacgccatgctgcagtggtcgttgctggacgatccggcc
catcgcgggctgcagcgcctggtcgcggatctcaaccacgtctacgccaccctgcccgaa
ctgcattgccgcgacgccgacccgagcggcttcgcctggatcgtcggcgacgacgcggac
aacagcgtgctcgccttcgcccgcgtggacgccagccattgcctggtggccgtgtgcaac
ttcacgccggtgccgcgaccgggctatcgcttcggcgtaccccacgcgggcgactggcgc
gtacgcgtggacaccggggcgacgcgctacggcggcgccggcggcggtccgcccatctgc
ctgcgcagcgaacccatcccggcccatgggcacccgcaatcgctggtcctggacctgccc
ggcttcaccgcgctgtacctgcgccactcggagtaa

DBGET integrated database retrieval system