KEGG   Bordetella parapertussis 12822: BPP2897Help
Entry
BPP2897           CDS       T00140                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BPP2897 (malQ)
Enzymes [BR:bpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BPP2897 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3109248..3111266
Genome map
AA seq 672 aa AA seqDB search
MSENQALARLCALAGVSPRWTDVWGRTRAVAPPVLRAVLAALDLPAATPAQAADTLARWR
ARRPAMLTARAGGMLRVPGDAAAPYAIELDNGQVAHGLAEPDGAGGLALRAPRQPGYHTL
RLGSASIALAVAPPRAPTLARLLASPRPRRWGVAAQIYSLRGTADPDGGHGDFGALAELA
VAAAGHGADAVALSPAHALFAAAPRRCSPYSPSTRLFLNILYADPLDTFSDAECAAARRP
SSGADAPLIDWPQAAGARLAMLRRLHRGLAADDPRAAELARFRAEGGQALRDHALFEALH
AANGATDWRGWPAAWRRPAAALAAGCAREHAREMDFHVFAQWLARRSLAHAQAAARAAGM
GVGLIADLAVGVDPAGSQTWAQPDAMLGGLNVGAAPDLRHPGGQDWRLTACSPATLATQG
YAAYIDMLRRALASAGGVRIDHVLGLARLWVIPEGAPPDQGAYLAFPVEDLLRLAALEAW
RHRAVLIGENLGTVPRDFNARLRAHGVLGMDVLWLQRETGPGGAGRFRPPGRWPASAVAM
TSTHDLPTLRGWWQARDLDWCVPAHEADAQRRQRDQDRRALWRQAAPPGLAATAPPAEPP
CAALLSHVARSRAPLMLVPLEDLAGLAEQPNVPGCPDHPNWRRRMPATAAAMLVQPAARL
ALAAIAAHRGRP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaaccaggccctcgcccggctgtgcgcgctggcgggcgtctcgccgcgctgg
accgatgtatggggccgcacgcgtgccgtcgccccgccggtcttgcgcgcggtactggcc
gcgctcgacctgcccgcggctacgccggcccaggccgccgacaccctggcgcgctggcgc
gcccggcgtccggccatgctgaccgcgcgcgccggcgggatgctgcgcgtgcccggcgac
gcggccgcgccctacgccatcgaactggacaacggccaggtggcgcacggcctggccgag
cccgatggcgccggcggcctggcgctgcgcgcacccaggcaacccggctaccacacgttg
cggctgggcagcgcgtccatcgccttggcggtcgcgccgccgcgcgcgcccacgctggcg
cgcctgctcgccagtccacggccgcgccgctggggcgtggccgcgcagatctacagcttg
cgcggcacggccgaccccgatggcggccatggcgatttcggcgcgctggccgaactggcg
gtcgccgcggcgggccacggcgccgacgcggtggcgctcagccccgcacacgcgctgttt
gccgccgctccgcggcgctgcagcccgtactcgccctccacgcggctgttcctcaacatc
ctgtacgcggacccgctcgacaccttcagcgacgccgaatgcgccgccgcgcgccggccc
tcgtccggcgccgacgcccccctgatcgactggccgcaggccgcgggcgcgcggctggcc
atgttgcggcgcctgcaccgcggcctggccgccgacgacccgcgcgccgccgaactggcg
cgctttcgcgccgaaggcggccaggcgctgcgcgaccacgccctgttcgaggccttgcac
gcggccaatggcgccaccgactggcgcggctggccggcggcgtggcgccgccccgccgcg
gcgctggccgccggctgcgcgcgcgaacatgcgcgcgagatggatttccacgtctttgcc
cagtggctggcgcggcgcagcctggcgcacgcccaggccgccgcgcgcgcggcgggcatg
ggcgtggggctgatcgcggacctcgccgtcggggtggacccggccggcagccagacctgg
gcccagcccgacgccatgctcggcgggctgaacgtgggcgcggcgcccgacctgcgccac
cccggcgggcaggactggcgcctgaccgcctgctcgcccgccacgctcgccacgcaaggc
tacgcggcctacatcgacatgctgcgtcgcgcgctggccagcgccggcggcgtgcgcatc
gaccacgtactcggcctggcgcgcctttgggtcatccccgagggcgcgccgcccgaccag
ggcgcgtacctggcctttccggtcgaagacctgctgcgcctggcggccctggaagcgtgg
cgccaccgcgccgtgctcatcggcgagaacctcggcacggtgccgcgggacttcaacgcg
cgcctgcgcgcgcacggcgtgctcgggatggacgtactgtggctgcagcgcgagaccggg
ccaggcggcgcgggacgctttcgcccgccgggccgctggcccgccagcgccgtcgccatg
accagcacgcacgacttgcctaccctgcgaggctggtggcaggcgcgcgatctggactgg
tgcgtgcctgcgcacgaggccgacgcgcagcgccggcagcgcgaccaggaccggcgcgcc
ctgtggcgccaggcggccccgcccggcctggccgctacggcgccgcccgccgagccgccc
tgcgccgccctgctgtcccatgtggcgcgcagccgtgcgccgctgatgctggtgccgctc
gaggatctggcggggctggccgaacagcccaacgtgccgggctgcccggaccatcccaat
tggcgccggcgcatgcccgcaaccgccgcggcgatgctggtgcagccggccgcgcgcctg
gcgctggcggcgatcgccgcgcaccggggacggccatga

DBGET integrated database retrieval system