KEGG   Bordetella parapertussis 12822: BPP2917Help
Entry
BPP2917           CDS       T00140                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BPP2917
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BPP2917
Enzymes [BR:bpa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BPP2917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3131903..3132403
Genome map
AA seq 166 aa AA seqDB search
MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGLEELYRSYRNEGFVVL
GFPCNQFGRQEPGDEAAIAQFCETQYAISFPLFAKIDVNGAHAHPLYRWLKAHKPGLLGT
RAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACAAPGPTP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatgtacgacttcagcgcccccaccataacgggcgcggaacgcgcgctggcc
gattttcgcggccaggtggcgctggtggtcaatgtcgcctcgcgctgcgggttcacgccc
cagtactcgggcctggaagaactgtaccgctcgtaccgcaacgaaggctttgtcgtcctg
ggatttccgtgcaaccagttcgggcgccaggagccgggcgacgaggccgccattgcgcag
ttctgcgaaacccagtacgccatcagcttcccgctgttcgccaagatcgacgtcaacggc
gcccacgcccacccgctgtaccgctggctgaaggcacacaagcccggcctgctgggcacc
cgcgccatcaaatggaatttcaccaaattcctggtcgggcgcgacggcctgccgctgcgg
cgctacgcgcccgcccacacgcccgaatcgctgcgccacgacatcgcgcgcgcctgcgcc
gcgcccggcccgacgccctag

DBGET integrated database retrieval system