KEGG   Bordetella parapertussis 12822: BPP3043Help
Entry
BPP3043           CDS       T00140                                 

Gene name
tesA
Definition
acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BPP3043 (tesA)
Enzymes [BR:bpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BPP3043 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BPP3043 (tesA)
Lipid biosynthesis proteins [BR:bpa01004]
 Fatty acid synthase
  Component type
   BPP3043 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3282586..3283194
Genome map
AA seq 202 aa AA seqDB search
MPAQAQTAAAPTGSAPHAVLVVGDSLSAEYGLRRGSGWVPMLAQRVSQQYPNYRVVNASI
SGDTTSGGLARLPALLRQHAPAVVVLELGSNDALRGLALDMTERNLRAMAQASRQAGASV
LVVGMQIPPNYGRDYTQRFAQVFPAVAEQEKARLVPFLMEGIATNRAMFQADGIHPNEDA
QPALLDNVWPVLEPMLAQPAAD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgccggcccaggctcagaccgcggccgcgcccacaggttccgcaccgcacgccgtcctg
gtggtcggcgacagcctgtcggccgaatatggcctgcggcgcgggtccggctgggtgccg
atgctggcccagcgggtttcgcaacaataccccaactaccgcgtcgtcaatgccagcatc
agcggcgatacgaccagcggcgggctggcgcgcctgccggcgctgctgcgccagcacgcg
ccggccgtcgtcgtgctggaactggggtccaacgatgccctgcgcggcctggcgctggac
atgaccgagcgcaatctgcgcgccatggcgcaggcgtcgcgccaggccggcgcatcggtg
ctggtggtcggcatgcagatcccgccgaactacggccgcgactacacacagcgcttcgcg
caggtctttccagccgtggccgaacaggaaaaagcccggctggtgccgttcctcatggaa
ggaatcgccaccaaccgggccatgttccaggccgacggcatccatcccaacgaggacgcc
cagccggcgctgcttgacaatgtctggcccgtgctcgagccgatgctggctcagcccgcg
gccgactga

DBGET integrated database retrieval system