KEGG   Bordetella parapertussis 12822: BPP3216Help
Entry
BPP3216           CDS       T00140                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:bpa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpa00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bpa00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3464975..3466192)
Genome map
AA seq 405 aa AA seqDB search
MAITDVLVPQLSESVSEATLLTWKKQAGAAVEADEILIEIETDKVVLEVPAPSSGVLSEI
VMGDGSTVTSGEVIARIDTAAKAAAAPAAAAEAPAAAAAAPAAAAPAAASSAASGVASPA
AAKILAEKGVDAASVAGTGRDGRVTKGDALAAGNAPAAKAAAPVAPPTLSLDGRPEQRVP
MSRLRARIAERLLQSQAENAILTTFNEVNMQAVMDLRARYKDKFEKEHGVKLGFMSFFVK
AAVAALKKYPVLNASVDGKDIIYHGYFDIGIAVGTPRGLVVPILRNADQLTIAEIEKTIA
DFGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQAAILGIHATKERPVVENG
QIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgttctcgtccctcaactgtccgaatcggtttcggaagccacgctg
ctgacctggaagaagcaggcgggcgccgcggtcgaggccgacgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgccggccccgtcgtcgggcgtgctgtccgaaatc
gtcatgggtgacggcagcaccgtgacctcgggcgaagtcattgcccgcatcgacacggcc
gccaaggctgctgcggcgcctgccgccgctgccgaagcgcccgccgccgctgctgctgcg
ccggcagccgccgcgccggcggcggccagcagcgccgccagcggcgtggcctcgccggcc
gccgccaagatcctcgccgagaagggcgtggacgccgccagcgtggccggcaccggccgc
gacggccgcgtcaccaagggcgacgccctggccgcgggcaacgcgcccgccgccaaggcc
gccgcgccggtggcgccgcccacgctgtcgctggacggccgccccgagcagcgcgtgccg
atgagccgcctgcgcgcccgcatcgccgagcgcctgctgcaatcgcaagccgagaacgcc
atcctgacgacgttcaacgaagtcaacatgcaggccgtgatggacctgcgcgcccgctac
aaggacaagttcgagaaagagcacggcgtcaagctgggcttcatgtcgttcttcgtcaag
gccgccgtcgccgcgctgaagaagtacccggtgctcaacgcctcggtcgacggcaaggac
atcatctaccacggctacttcgacatcggcatcgccgtcggcaccccgcgtggcctggtg
gtgcccatcctgcgcaacgccgaccagctgaccatcgccgaaatcgagaagaccatcgcc
gacttcggcaagcgcgccgcggacggcaagctgggcatcgaggaaatgaccggcggcacg
ttctcgatctccaacggcggggtgttcggctcgatgctgtccacacccatcatcaacccg
ccgcaggcggccatcctgggcatccacgccaccaaggagcgcccggtggtcgagaacggc
cagatcgtcatccggccgatcaactacctggccatgtcctatgaccaccgcatcatcgac
ggccgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaagacccgcaacgc
ctgttgctggatctgtaa

DBGET integrated database retrieval system