KEGG   Bordetella parapertussis 12822: BPP3229Help
Entry
BPP3229           CDS       T00140                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00020  Citrate cycle (TCA cycle)
bpa00190  Oxidative phosphorylation
bpa00650  Butanoate metabolism
bpa01100  Metabolic pathways
bpa01110  Biosynthesis of secondary metabolites
bpa01120  Microbial metabolism in diverse environments
bpa01130  Biosynthesis of antibiotics
bpa01200  Carbon metabolism
Module
bpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPP3229 (sdhD)
   00650 Butanoate metabolism
    BPP3229 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BPP3229 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Bap31 CybS
Motif
Other DBs
NCBI-ProteinID: CAE38514
GeneDB: BPP3229
UniProt: Q7W5R1
Position
complement(3483979..3484362)
Genome map
AA seq 127 aa AA seqDB search
MADTKNYGPKRLVVGAHYGVTDFIAQRITAVILAVYTLVLIVGLLIMPAFTYENWKALFT
FHVFALPVGQILASLAFFALAWHAWIGVRDIWMDYVRPVGVRLLLQVLTILWLVGSVVYF
AQILWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgaaaaactatggccccaagcgcctggtcgtcggcgcccactacggggtt
accgatttcatcgcccagcgcatcaccgccgtcatcctggccgtgtataccctggtgctg
atcgtcggcctgctgatcatgccggctttcacgtatgaaaactggaaggccctgttcacc
ttccacgtgttcgcccttccggtgggccagatcttggcctcgctcgctttctttgcgctg
gcctggcatgcctggatcggcgtgcgcgacatctggatggactatgtccgcccggtaggc
gtgcgcctgctgctgcaggtgctgaccatcctctggctggtcggttcggtcgtctacttc
gcgcaaatcctctggagaatctaa

DBGET integrated database retrieval system