KEGG   Bordetella parapertussis 12822: BPP3286Help
Entry
BPP3286           CDS       T00140                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BPP3286
   00240 Pyrimidine metabolism
    BPP3286
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BPP3286
   03430 Mismatch repair
    BPP3286
   03440 Homologous recombination
    BPP3286
Enzymes [BR:bpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BPP3286
DNA replication proteins [BR:bpa03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BPP3286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3545829..3546284
Genome map
AA seq 151 aa AA seqDB search
MTRIDFAFGAPDRLRAACRTARKRFQAGQRLVVYCADGGRLAAFDRMLWALEDVSFVPHV
LANDALAADTPVLLTAGDPAAALALATTGDSRPWLLNLDDGCPPNFDGYERLLEIVSDDP
ADRQAARQRWRDYQNAGHALHSHDLSRAGEA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcatcgacttcgccttcggcgctccggaccgcctgcgcgcggcctgccgcacc
gcacgcaagcgcttccaggcgggccagcggctggtggtctactgcgccgacggcggacgc
ctggccgccttcgaccggatgctgtgggccctggaggacgtctcgttcgtgccgcatgtg
ctggccaacgacgcgctggcggccgacacgccggtcctactgaccgcgggcgaccccgcc
gctgccctggcgctggccaccaccggcgacagccgcccctggctgctgaacctggatgac
ggctgcccgcccaacttcgatggctacgagcgcctgctggaaatcgtctccgacgacccg
gccgaccgccaggcggcgcgccagcgctggcgcgactatcagaatgccggccatgcgctg
cacagccatgacctgagccgcgcgggcgaggcctga

DBGET integrated database retrieval system