KEGG   Bordetella parapertussis 12822: BPP3323Help
Entry
BPP3323           CDS       T00140                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPP3323 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPP3323 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPP3323 (trpB)
Enzymes [BR:bpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPP3323 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
complement(3580625..3581824)
Genome map
AA seq 399 aa AA seqDB search
MKPYDLPDARGHFGPYGGVFVAETLMHALDELRAAYDQCRVDPSFIDEFNYELKHFVGRP
SPVYHASRWSQRLGGAQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGAGQH
GVATATVAARYGMECVVFMGSEDVRRQASNVYRMKLLGATVVPVDSGSRTLKDALNEAMR
DWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGQECLTQMPEVIGRQPDYVVAAVGGGS
NAMGIFHPYIPYENVRLIGVEAAGEGMETGRHAASLAAGQIGVLHGNRTYVMQNADGQVQ
ETHSVSAGLDYPGVGPEHAWLKDSGRAEYAGITDDEALAAFHDCCRIEGIMPALESAHAI
AQAVKMAPALSKDKVILVNLSGRGDKDMHTVAERAGLQL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccttacgaccttccggatgcccggggccatttcggcccctatggcggtgtgttt
gtggcggaaacgctgatgcacgccctagacgagctgcgcgcggcctatgaccagtgccgc
gtcgatcccagcttcatcgacgagttcaattacgagctcaagcatttcgtcggccggccc
agcccggtctaccacgccagccgctggtcgcagcgcctgggcggcgcgcagatctggttc
aagcgcgaagacctcaaccatacgggcgcgcacaaggtcaacaattgcatcggccaggcg
ctgctggcgcggcgcatgggcaagccgcgcgtcatcgccgagaccggcgccggccagcac
ggcgtggccacggccacggtagcggcccgctatggcatggaatgcgtggtgttcatgggc
agcgaggacgtgcgccgccaggcctccaacgtctatcgcatgaagctgctgggcgccacg
gtggtgccggtggactcgggctcgcgcaccctgaaggacgcgctgaacgaagccatgcgc
gactgggtcaccaacatcgagaatacgttctacatcatcggcacggtggccgggcccgac
ccctacccgcgcatggtgcgcgacttccagaccgtcatcggccaggagtgcctgacccag
atgcccgaagtcatcggccgccagcccgactatgtggtcgcggcggtgggcggcggctcc
aacgccatgggcattttccatccctatatcccgtacgagaacgtgcgcctgatcggcgtc
gaggcggcgggcgagggcatggaaaccggccgccatgcggcctcgctggcggcgggccag
atcggcgtgctgcacggcaaccgcacctatgtcatgcagaatgccgacggccaggtgcag
gaaacccattcggtgtcggccgggctggattatcccggcgtggggccggagcatgcgtgg
ctcaaggacagcggccgcgccgagtacgcgggcatcaccgacgacgaggcgctggcggcg
ttccacgattgctgccgcatcgagggcatcatgccggcgctggagtccgcgcacgccatt
gcgcaggccgtgaaaatggcgcccgcgctttccaaggacaaggtcatcctggtcaatctg
tccggccggggcgacaaagacatgcacaccgtggccgagcgcgcgggccttcagctctga

DBGET integrated database retrieval system