KEGG   Bordetella parapertussis 12822: BPP3426Help
Entry
BPP3426           CDS       T00140                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00010  Glycolysis / Gluconeogenesis
bpa00051  Fructose and mannose metabolism
bpa00562  Inositol phosphate metabolism
bpa01100  Metabolic pathways
bpa01110  Biosynthesis of secondary metabolites
bpa01120  Microbial metabolism in diverse environments
bpa01130  Biosynthesis of antibiotics
bpa01200  Carbon metabolism
bpa01230  Biosynthesis of amino acids
Module
bpa_M00002  Glycolysis, core module involving three-carbon compounds
bpa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP3426 (tpiA)
   00051 Fructose and mannose metabolism
    BPP3426 (tpiA)
   00562 Inositol phosphate metabolism
    BPP3426 (tpiA)
Enzymes [BR:bpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BPP3426 (tpiA)
Exosome [BR:bpa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BPP3426 (tpiA)
  Exosomal proteins of bladder cancer cells
   BPP3426 (tpiA)
  Exosomal proteins of melanoma cells
   BPP3426 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAE38711
GeneDB: BPP3426
UniProt: Q7W575
Position
complement(3699971..3700717)
Genome map
AA seq 248 aa AA seqDB search
MTTAENRARLVLGNWKMHGNLAENAALLAELRAADAAAHCEMGVCVPFPYLAQTAAALQG
SAIGWGAQDVSAHAKGAYTGEVAAPMLAEFGCRWVLVGHSERRTLHAESDQLVADKARAA
LEAGLTPVVCVGESLQEREGGNTLGVIERQLEPVLALGRDALVRMVLAYEPVWAIGTGRT
ASPEQAQEVHSAIRVALDGLQASQVRVLYGGSVKGANAASLFAMPDIDGGLVGGASLVAE
EFLRIAAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagctgagaatcgcgcccgcctggtgctgggcaactggaagatgcacggcaac
ctggccgagaacgccgccttgctggccgagttgcgcgccgccgatgccgccgcccattgc
gaaatgggggtgtgcgtgccgtttccgtacctggcccagaccgctgccgccttgcagggc
agcgccatcggctggggcgcgcaggatgtcagcgcgcacgccaagggcgcctacaccggc
gaagtcgccgcccccatgctggccgaattcggctgccgctgggtgctggtgggccactcc
gagcggcgcacgctgcatgccgagagcgaccagctggtggccgacaaggcccgcgccgcg
ctcgaggcaggcctgaccccggtggtttgcgtcggcgaatcgctgcaagagcgcgaaggc
ggcaacaccctgggcgtgatcgagcgccagctcgaacccgtcctggccctgggccgcgat
gccctggtccgcatggtcctcgcctacgaacccgtctgggccatcggcaccggccgtact
gccagccccgagcaggcgcaggaagtgcacagcgccatccgcgtggcgctcgacggcctg
caagccagccaggtgcgcgtgctgtacggcggcagcgtcaagggggccaacgccgccagc
ctgttcgccatgcccgacatcgacggcggcctggtgggcggggcctcgctcgtcgctgaa
gaattcctgcgcatcgccgcagcttaa

DBGET integrated database retrieval system