KEGG   Bordetella parapertussis 12822: BPP3441Help
Entry
BPP3441           CDS       T00140                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BPP3441
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BPP3441
Enzymes [BR:bpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BPP3441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3717545..3718327)
Genome map
AA seq 260 aa AA seqDB search
MLKGKVAVVTGSTSGIGLGIASALAQQGADIVLNGFGDAADIEKLRAGLASQYGVQVRYD
GADLSKGEAVRQLVSGAVAELGRIDILVNNAGIQHTALIEDFPADKWDAIIALNLSAVFH
GTAAALPHMKKQGWGRIINIASAHGLVASAAKSAYVAAKHGVVGLTKVTALETAGMGITA
NAICPGWVRTPLVEKQITALAAKDGVDQESAARELLGEKQPSLQFVTPEQLGGTAVFLAS
EAAAQITGTTISVDGGWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaggaaaagttgcagtcgtcaccggttccaccagcggcatcggcctggggatc
gccagcgcgctggcgcagcagggcgccgacatcgtgctcaacggattcggcgacgcggcg
gacatcgagaaattgcgggccgggctggccagccagtacggcgtgcaggtgcgctatgac
ggcgccgacctgtccaagggcgaggcggtgcggcaactggtgtccggcgccgtcgccgag
ctgggccgcatcgatatcctggtcaacaacgcgggcatccagcacaccgccttgatcgag
gactttcccgccgacaagtgggacgccatcatcgcgctgaatctctcggcggtattccat
ggcacggccgcggcgctgccccacatgaagaagcagggctgggggcgcatcatcaacatc
gcctcggcccatggcctggtggcctcggccgcgaagtccgcctacgtggccgccaagcac
ggcgtggtcggcctgaccaaggtcaccgcgctggagacggccggcatgggcatcaccgcc
aacgccatctgccccggctgggtgcgcacgccgttggtggaaaagcagatcaccgccctg
gcggccaaggacggcgtcgaccaggaaagcgccgcgcgcgaactgctcggcgagaagcag
ccgtcgctgcagttcgtcacgcccgagcaactgggcggcacggccgtgttcctggcctcg
gaggccgcggcccagatcaccggcaccaccatttccgtcgacggcggctggacagcccgc
tag

DBGET integrated database retrieval system