KEGG   Bordetella parapertussis 12822: BPP3568Help
Entry
BPP3568           CDS       T00140                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPP3568 (ruvA)
Enzymes [BR:bpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BPP3568 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3854396..3854968
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKSPPVVCVDVNGVGYEIDVPMSTLYALPETGARVTLFTHLVVREDAQLL
YGFGSSAERSTFRELIKVTGIGARTALAVLSGLSVAELSQAITLQETGRLTRVPGIGKKT
AERLLLEMRGKLGADIGATPHAAGGHQSDILNALLALGYSDKESQAALKKLPEGVDVSEG
IRLALKALVR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcattaccggaaccctcatcgagaaatcgccgcccgtcgtctgtgtcgac
gtcaacggagtgggctatgaaatcgatgtccccatgagcaccctgtacgcgctgcccgag
accggcgcgcgggtcaccctgttcacccacctggtggtgcgcgaggatgcgcagctgctg
tacgggttcggcagcagcgccgagcgcagcacgttccgcgagctgatcaaggtgaccggc
atcggcgcgcgcaccgcgctggcggtcctgtcggggctgtcggtggccgagctgtcgcag
gccatcacgctgcaggagaccgggcgcctcacgcgcgtgccgggcatcggcaagaagacc
gcggagcgcctgctgctggagatgcgcggcaagctgggcgcggacatcggcgccaccccg
cacgcggccggcggccaccagagcgatatcctcaacgcgctgctggcgctgggctactcc
gacaaggagtcccaggcggcgctcaagaagctgcccgaaggggtggacgtatcggaaggc
atccgcctggcgctcaaggccctggtccgctag

DBGET integrated database retrieval system