KEGG   Bordetella parapertussis 12822: BPP3647Help
Entry
BPP3647           CDS       T00140                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BPP3647
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPP3647
   00650 Butanoate metabolism
    BPP3647
  Lipid metabolism
   00071 Fatty acid degradation
    BPP3647
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPP3647
   00310 Lysine degradation
    BPP3647
   00360 Phenylalanine metabolism
    BPP3647
   00380 Tryptophan metabolism
    BPP3647
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPP3647
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPP3647
   00281 Geraniol degradation
    BPP3647
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPP3647
   00627 Aminobenzoate degradation
    BPP3647
   00930 Caprolactam degradation
    BPP3647
Enzymes [BR:bpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPP3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3943100..3943867)
Genome map
AA seq 255 aa AA seqDB search
MSELVKVEIADGIQIITVNRPEARNAINFETAQAMAAALDQLDERDDVRIGILTGAGGTF
SAGMDLKAFARTGQRPSLPERGFAALTERPPKKPLIAAVEGYALAGGCEMALSCDLLVAA
DNAKFGLPEVKRGLVPGAGGMLRLPRRLPYHIAMEIILTGDFLDASRAHALGLVNRLTAA
GGALEGALALARVIVENGPLAVQVAKSIVAQSGDWDQETMFDRQRPQVTEIFTSADAKEG
ATAFAEKRKPVWQGK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaactggtcaaggtggaaatcgccgacggcatccagatcatcacggtcaaccgt
cccgaagccaggaacgccatcaatttcgaaacggcgcaggccatggccgccgcgctggac
caactcgatgagcgcgacgacgtgcgtatcggcatcctgaccggcgcgggcggcacgttc
tcggccggcatggacttgaaggcgttcgcccggaccggacagcgcccgtcgctacccgag
cgtggctttgccgccctgaccgaacgcccgccgaagaaaccgctgatcgcggcggtcgag
ggctatgcgctggccggtggctgcgaaatggccctgagctgcgatctgctggtggccgcc
gacaatgccaagttcggcctgcccgaagtcaagcgcggcctggtgccgggcgccggcggc
atgctgcgcctgccgcgccggctgccgtaccacatcgccatggaaatcatcctgacgggc
gatttcctggatgcgtcgcgcgcccatgcgctgggcctggtcaaccgcctgacggcggcc
ggcggcgcgctggaaggcgcgctggcgctggcccgcgtcatcgtcgagaacggcccgctg
gcggtgcaggttgccaagagcatcgtcgcgcaatcgggcgactgggaccaggaaaccatg
ttcgaccgccagcgtccgcaggtcaccgaaatcttcacctcggccgacgccaaggaaggc
gccaccgccttcgccgagaagcgcaagcctgtctggcaaggcaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system