KEGG   Bordetella parapertussis 12822: BPP3647Help
Entry
BPP3647           CDS       T00140                                 

Definition
(GenBank) carnitinyl-CoA dehydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00071  Fatty acid degradation
bpa00280  Valine, leucine and isoleucine degradation
bpa00281  Geraniol degradation
bpa00310  Lysine degradation
bpa00360  Phenylalanine metabolism
bpa00362  Benzoate degradation
bpa00380  Tryptophan metabolism
bpa00410  beta-Alanine metabolism
bpa00627  Aminobenzoate degradation
bpa00640  Propanoate metabolism
bpa00650  Butanoate metabolism
bpa00903  Limonene and pinene degradation
bpa00930  Caprolactam degradation
bpa01100  Metabolic pathways
bpa01110  Biosynthesis of secondary metabolites
bpa01120  Microbial metabolism in diverse environments
bpa01130  Biosynthesis of antibiotics
bpa01212  Fatty acid metabolism
Module
bpa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPP3647
   00650 Butanoate metabolism
    BPP3647
  Lipid metabolism
   00071 Fatty acid degradation
    BPP3647
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPP3647
   00310 Lysine degradation
    BPP3647
   00360 Phenylalanine metabolism
    BPP3647
   00380 Tryptophan metabolism
    BPP3647
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPP3647
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPP3647
   00281 Geraniol degradation
    BPP3647
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPP3647
   00627 Aminobenzoate degradation
    BPP3647
   00930 Caprolactam degradation
    BPP3647
Enzymes [BR:bpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPP3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAE38931
GeneDB: BPP3647
UniProt: Q7W4L3
Position
complement(3943100..3943867)
Genome map
AA seq 255 aa AA seqDB search
MSELVKVEIADGIQIITVNRPEARNAINFETAQAMAAALDQLDERDDVRIGILTGAGGTF
SAGMDLKAFARTGQRPSLPERGFAALTERPPKKPLIAAVEGYALAGGCEMALSCDLLVAA
DNAKFGLPEVKRGLVPGAGGMLRLPRRLPYHIAMEIILTGDFLDASRAHALGLVNRLTAA
GGALEGALALARVIVENGPLAVQVAKSIVAQSGDWDQETMFDRQRPQVTEIFTSADAKEG
ATAFAEKRKPVWQGK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaactggtcaaggtggaaatcgccgacggcatccagatcatcacggtcaaccgt
cccgaagccaggaacgccatcaatttcgaaacggcgcaggccatggccgccgcgctggac
caactcgatgagcgcgacgacgtgcgtatcggcatcctgaccggcgcgggcggcacgttc
tcggccggcatggacttgaaggcgttcgcccggaccggacagcgcccgtcgctacccgag
cgtggctttgccgccctgaccgaacgcccgccgaagaaaccgctgatcgcggcggtcgag
ggctatgcgctggccggtggctgcgaaatggccctgagctgcgatctgctggtggccgcc
gacaatgccaagttcggcctgcccgaagtcaagcgcggcctggtgccgggcgccggcggc
atgctgcgcctgccgcgccggctgccgtaccacatcgccatggaaatcatcctgacgggc
gatttcctggatgcgtcgcgcgcccatgcgctgggcctggtcaaccgcctgacggcggcc
ggcggcgcgctggaaggcgcgctggcgctggcccgcgtcatcgtcgagaacggcccgctg
gcggtgcaggttgccaagagcatcgtcgcgcaatcgggcgactgggaccaggaaaccatg
ttcgaccgccagcgtccgcaggtcaccgaaatcttcacctcggccgacgccaaggaaggc
gccaccgccttcgccgagaagcgcaagcctgtctggcaaggcaaataa

DBGET integrated database retrieval system