KEGG   Bordetella parapertussis 12822: BPP3930Help
Entry
BPP3930           CDS       T00140                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00240  Pyrimidine metabolism
bpa00250  Alanine, aspartate and glutamate metabolism
bpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BPP3930 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPP3930 (pyrB)
Enzymes [BR:bpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BPP3930 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CAE39213
GeneDB: BPP3930
UniProt: Q7W3U7
Position
complement(4254885..4255838)
Genome map
AA seq 317 aa AA seqDB search
MLNPQLNRHGELIHLLSTEGLPRRIIEQILDLAATFVPAPGQEFPKLPLLHGKSVFNLFF
ENSTRTRTTFEIAAKRLSADVVNLNIAASSTSKGESLLDTIANLSAMQAGLFVVRHGASG
APYLIAQHVAPHVHVINAGDGRHAHPTQALLDMYTIRHHKGDFNQLTVAIVGDVLHSRVA
RSDIHALTTLGVPEVRVVAPATLLPEGLAQMGVRVCTDMEEGLRDADVVIMLRLQNERMR
GALLPSAHEYFKHYGLTQARLALARPDAIVMHPGPMNRGVEIASEVADSGQAVILDQVTF
GIAVRMAAMSLVAGVRP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatccccaactcaatcgccacggcgagctgatccacctgctgtccaccgaaggc
ctgccgcgccgcatcatcgagcagatcctcgacctggccgccaccttcgtgccggcgccc
ggacaggaattccccaagctgcccctgctgcacggcaaaagcgtgttcaacctgttcttc
gagaactccacccgcacgcgcaccaccttcgagatcgccgccaagcgcctgtcggccgac
gtggtcaacctgaacatcgccgcctcgtccacgtccaagggcgaatccctgctcgatacc
atcgccaacctgtcggccatgcaggccggcctgttcgtggtgcgccacggcgccagcggc
gcgccgtacctgatcgcgcagcacgtggcgccccatgtccatgtcatcaacgccggcgac
ggccgccatgcgcatcccacgcaggccttgctggacatgtacaccatccgtcaccacaag
ggcgatttcaaccagctgacggtggccatcgtcggcgacgtactgcattcgcgcgtggcg
cgctccgacatccacgccctgaccacgctgggcgtgcccgaagtgcgcgtggtggcgccg
gccacgctgctgcccgaggggctggcgcagatgggcgtgcgcgtctgtaccgacatggaa
gaagggctgcgcgacgccgacgtcgtcatcatgctgcgcctgcagaacgaacgcatgcgc
ggcgcgctgctgccgtcggcgcacgaatacttcaagcactatggcctgacgcaggcccgc
ctggcgctggcccggcccgacgccatcgtgatgcacccggggccgatgaaccgcggcgtc
gagatcgcctccgaggtggccgacagcggccaggccgtgatactggaccaggtgacattc
ggcatcgcggtgcgcatggccgccatgagcctggtcgcgggagtacggccatga

DBGET integrated database retrieval system