KEGG   Bordetella parapertussis 12822: BPP3988Help
Entry
BPP3988           CDS       T00140                                 

Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpa  Bordetella parapertussis 12822
Brite
Enzymes [BR:bpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BPP3988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD MTS Methyltransf_25 Methyltransf_11 PrmA Methyltransf_31 Methyltransf_23 Methyltransf_18 Methyltransf_12 Met_10 NodS TehB DUF43 tRNA_U5-meth_tr DUF938 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: CAE39271
GeneDB: BPP3988
UniProt: Q7W3P3
Position
4322499..4323179
Genome map
AA seq 226 aa AA seqDB search
MNTSTLPDVEQARFNMMEQQIRPWDVLDPKVLDALFAVRRELFVPPALRALAFSDLEIPL
EINAVNTRQNMLAPKIEARLAQELLLQPTDCVLEIGTGSGYQAALLAHLAQQVTTVEIDS
RLATFAQQNLQVNNVADVKVETGDGRNGWGSTEYDAILVTGSVPVVPDALKYQLRVGGRL
VVIVGQAPIMTAYRITRTTAASFETVSLFETVIKPLRGTTVSQFKF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctcgaccctgcccgacgtagaacaagcccgattcaacatgatggaacagcaa
atccgcccctgggacgtgctggaccccaaggtgctggacgccctgttcgccgtgcgccgg
gaattgttcgtgccgccggcgctacgcgccctggccttctccgacctcgaaatcccgctt
gaaatcaacgcggtcaacacgcgccagaacatgctggcccccaaaatcgaggcgcgcctg
gcccaggaactgctgctgcagccgaccgactgtgtgctggagatcggcaccggctcgggc
taccaggccgccctgctggcacacctggcgcaacaggtgaccacggtcgaaatcgacagc
cgcctggccaccttcgcccagcagaacctgcaggtgaacaatgtggccgacgtcaaggtc
gaaacgggcgacggccgcaatggctggggctcgaccgaatacgacgcgatcctggtcacc
ggttcggtgccggtggtgcccgacgccctgaagtaccagttgcgcgtgggcggccggctg
gtcgtcatcgtcggacaggcgcccatcatgaccgcctaccgcatcacgcgcaccacggcc
gccagcttcgagaccgtctcgctgttcgagaccgtcatcaagccgctgcgcggcaccacc
gtatcccagttcaaattctga

DBGET integrated database retrieval system