KEGG   Bordetella parapertussis 12822: BPP4265Help
Entry
BPP4265           CDS       T00140                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpa00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4604967..4606235
Genome map
AA seq 422 aa AA seqDB search
MDKLRITGGSPLRGEVTVSGAKNAALPILCASLLTAEPLVLGNVPQLNDTSTTLRLLGRM
GVRAERAGDGTVTLQADQVDNLEAPYELVKTMRASILVLGPLLARFGQARVSLPGGCAIG
QRPVDQHIKGLAALGAEIEIEHGFVVARATRLKGASIRTDMVTVTGTENLLMAAVLAEGQ
TVLENAAREPEVVDLAELLIKMGARIQGHGTDRIVVDGVARLHGARHDVIADRIEAGTFL
CAVGAAGGDITLRGAAPDTMGATLDKLVEAGLTIETGPDWIRGAMHGRPCAVGARTHEYP
GFATDMQAQLMALDTVADGTAVIVENIFENRYMHVQELCRLGADIDIDGHTAVVRGVARL
SGATVMATDLRASASLVIAGLAAEGETLVDRIYHLDRGYDRMEVKLRALGASIQRVTGKE
TA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgcgcatcaccggcggctcgcccctgcgtggggaagtcaccgtctcgggc
gccaagaacgcggccctgcccatcctgtgcgccagcctgctcaccgccgagccgctcgtg
ctgggcaatgtgccgcaactgaacgacacctcgaccacgctgcgcctgctgggccgcatg
ggcgtgcgcgccgaacgcgccggcgacggcaccgtcaccctgcaggccgaccaggtcgac
aacctggaagcgccgtacgagctggtcaagaccatgcgcgcctcgatcctggtgctgggc
ccgctgctggcccgcttcggccaggcccgcgtcagcctgccgggcggctgcgcgatcggc
cagcggccggtcgaccagcacatcaaggggctggcggcgctgggcgccgagatcgagatc
gagcacggcttcgtggtggcgcgcgccacgcgcctgaagggcgcctcgatccgcaccgac
atggtcaccgtcaccggcaccgagaacctgctgatggcggcggtgctggccgaaggccag
accgtgctggaaaatgccgcgcgcgaacccgaagtggtcgacctggccgagctgctcatc
aagatgggcgcgcgcatccagggccacggcaccgaccgcatcgtcgtcgatggcgtcgcg
cggctgcacggcgcgcgccacgacgtcattgccgaccgcatcgaggccggcaccttcctg
tgcgcggtaggcgcggcaggcggcgacatcacgctgcgcggcgccgcgcccgacaccatg
ggcgccacgctggacaagctggtcgaggccggcctgaccatcgaaaccgggccggactgg
atccgcggcgccatgcacggccgcccctgcgccgtcggcgcgcgcacgcacgagtatccc
ggtttcgccaccgacatgcaggcccagctgatggcgctggacacggtcgccgacggcacc
gccgtcatcgtcgagaacatcttcgagaaccgctacatgcatgtgcaggagctgtgccgc
ctgggcgccgacatcgacatcgacggccataccgccgtcgtgcgcggggtcgcccggctg
tccggcgccaccgtcatggccaccgacctgcgcgcctcggccagcctggtgatcgccggc
ctggccgccgagggcgagaccctggtcgaccgcatctaccatctcgatcgcggttacgat
cggatggaagtcaaactgcgcgccctgggcgcgagcattcaacgcgtaactggcaaggaa
acggcatga

DBGET integrated database retrieval system