KEGG   Bordetella parapertussis Bpp5: BN117_0170Help
Entry
BN117_0170        CDS       T02297                                 

Gene name
rfbC
Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00521  Streptomycin biosynthesis
bpar00523  Polyketide sugar unit biosynthesis
bpar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BN117_0170 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN117_0170 (rfbC)
Enzymes [BR:bpar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BN117_0170 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-GeneID: 13888206
NCBI-ProteinID: YP_006894254
UniProt: K0M9W0
Position
complement(176965..177513)
Genome map
AA seq 182 aa AA seqDB search
MKLTPLAIADVVLIEPQVFGDERGCFFESFNQDRLDAQLGRRIRFVQDNHSCSRAGVLRG
LHYQILHPQAKLVRVVAGEAYDVAVDLRRGSPTFGRWTGAYLSARNRHQLWIPEGFAHGF
LALSDDTECLYKATDYYAPEHERCVRWDDPQLKVDWPLQGQAPILSVKDRQGVALARADT
YA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacccccttggccatcgcggacgtcgtgctgatcgaaccccaagtgttcggc
gacgagcgcggctgcttcttcgagagcttcaaccaggaccgcctggacgcgcaactgggg
cggcgcatccgcttcgtgcaggacaatcactcatgctcgcgcgcgggggtgctgcgcggc
ctgcactaccagatcctgcatccgcaggccaagctggtgcgcgtggtggcgggcgaagcc
tatgacgtggcggtggacctgcgccgcggctcgcccaccttcgggcgctggaccggcgcc
tacctgtcggcgcgcaaccggcaccagctgtggattccggaagggtttgcgcacggcttc
ctggcgttgtccgacgataccgagtgcctgtacaaggccaccgactactacgcgcccgaa
catgagcgctgcgtgcgctgggacgacccgcaactcaaggtggactggccgctgcagggc
caagcgcccatcctgtcggtgaaagaccgccagggcgtggcgctggcgcgggccgatacc
tatgcgtag

DBGET integrated database retrieval system