KEGG   Bordetella parapertussis Bpp5: BN117_0438Help
Entry
BN117_0438        CDS       T02297                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bpar00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456726..457427
Genome map
AA seq 233 aa AA seqDB search
MAYDLWYWDGIPGRGEFVRLALEAGKIPYRDRAREPGEDMLDDMRRRRDTPPFAPPYLVA
DGMTIAQTANILLFLGVEHGLAPPDRAGRLWVNQLQLTIADLTAEAHDVHHPVAAGLYYE
DQQDVALRRAADFRETRMPKFMQYFEQALDRPGGWLTDMGRWSYADLSLYHVVEGLLHAF
PRRMRTLVHRYPRLMALHARVAELPELRGYLASDRRLPFGDGIFRHYPELDGA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacgacctctggtactgggacggcatacccggccgtggcgagttcgtgcggctg
gcgctggaggcgggcaagatcccgtatcgcgaccgcgcccgcgagcccggcgaagacatg
ctggacgacatgcggcgccggcgcgacacgccgccgtttgcgccgccctacctggtcgcc
gatggcatgaccatcgcacagacggccaatatcctgctgttcctgggcgtggagcatggc
ctggcgccgccggaccgcgccggccgcctgtgggtcaaccagctgcagctcaccattgcg
gacctgacggccgaagcgcacgacgtgcaccatccggtcgccgccggcctctactacgaa
gaccagcaggacgtggcgctgcggcgggccgccgatttccgcgagacgcgcatgccgaag
ttcatgcagtacttcgagcaggcgctggacaggccgggcggctggctcaccgacatgggc
cgctggagctacgccgacctgtcgctgtatcacgtggtcgaaggcctgctgcatgccttt
ccgcggcgcatgcgcaccctggtgcaccgctatccgcggctgatggcgctgcatgcgcgc
gtggccgaattgccggaattgcgcggctacctggccagcgaccgccggctgccctttggc
gacggcattttccgccactatcccgaactcgacggcgcctga

DBGET integrated database retrieval system