KEGG   Bordetella parapertussis Bpp5: BN117_0574Help
Entry
BN117_0574        CDS       T02297                                 

Definition
(RefSeq) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00071  Fatty acid degradation
bpar00072  Synthesis and degradation of ketone bodies
bpar00280  Valine, leucine and isoleucine degradation
bpar00310  Lysine degradation
bpar00362  Benzoate degradation
bpar00380  Tryptophan metabolism
bpar00620  Pyruvate metabolism
bpar00630  Glyoxylate and dicarboxylate metabolism
bpar00640  Propanoate metabolism
bpar00650  Butanoate metabolism
bpar00900  Terpenoid backbone biosynthesis
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01120  Microbial metabolism in diverse environments
bpar01130  Biosynthesis of antibiotics
bpar01200  Carbon metabolism
bpar01212  Fatty acid metabolism
bpar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN117_0574
   00630 Glyoxylate and dicarboxylate metabolism
    BN117_0574
   00640 Propanoate metabolism
    BN117_0574
   00650 Butanoate metabolism
    BN117_0574
  Lipid metabolism
   00071 Fatty acid degradation
    BN117_0574
   00072 Synthesis and degradation of ketone bodies
    BN117_0574
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN117_0574
   00310 Lysine degradation
    BN117_0574
   00380 Tryptophan metabolism
    BN117_0574
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN117_0574
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN117_0574
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN117_0574
Enzymes [BR:bpar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN117_0574
Exosome [BR:bpar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN117_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt PTA_PTB
Motif
Other DBs
NCBI-GeneID: 13888610
NCBI-ProteinID: YP_006894623
UniProt: K0MDS4
Position
621650..622855
Genome map
AA seq 401 aa AA seqDB search
MRRAAIVSPLRTPVGAFGGALKAVPVEELGAAVARAIVQRTGLDPARIDDVVFAQSYASG
ETPCTGRWVALQAGFPIEVAGMQLDRRCGGGVQAVATAAMMVQTGAADVVMAGGVESMSN
VEHYTTDMRWGKRAGSVTLHDRLDRGRERSQPESRFGRISGMIETAETLAREYGISREQA
DLFAARSHQRAAAAQAAGHFDAEIVPISVAQRKGEPLLVGQDEGVRGETSAESLGRLRTI
MKEGVVTAGNACQQNDAAAACLIVAEDRLEELGLEPMGWLVGWAAAGCDPARMGIGPVPA
VSKVLARTGLGFDQMDLIELNEAFACQALACVKGWGSSMDALEDRLNVNGSGISLGHPVG
ATGVRIMTTLLHEMQRCKARYGLETMCIGGGQGIAMIVERA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagcagccatagtttctccgctgcgcacgcccgtgggggcattcggcggggca
ttgaaggcggttcccgtggaagagctgggcgccgccgtggcgcgcgccatcgtgcagcgt
acgggcctggacccggcacgcatcgacgacgtggtgttcgcccagagctacgccagcggc
gagacgccttgcaccgggcgctgggtggccctgcaggcggggttcccgatcgaagtggcc
ggcatgcagctggaccgccgctgcggcggcggcgtgcaggccgtggccacggcggccatg
atggtgcagaccggcgcggccgatgtggtcatggccggcggcgtcgagagcatgagcaac
gtcgagcactacacgaccgatatgcgctggggcaagcgcgccggctcggtcacgctgcac
gaccggctggaccgggggcgcgagcgctcgcagcccgagagccgctttggccgcatcagc
ggcatgatcgagacggccgagacgctggcgcgcgagtacggcatcagccgcgagcaggcc
gacctcttcgccgcgcgcagccaccagcgggcggccgcggcgcaggcggcgggccacttc
gatgcggagatcgttcccatctcggttgcgcaacgcaagggcgagcccctgctggtcggc
caggatgaaggcgtgcgcggcgagaccagcgccgagagcctgggcaggctgcgcaccatc
atgaaagagggcgtggtcaccgccggcaacgcctgccagcagaacgacgccgcggcggcg
tgcctgatcgtcgccgaggacaggctggaggagctcggcctcgaacccatgggctggctg
gtcggctgggctgcggccggctgcgacccggcgcgcatgggcatcggcccggtgccggcc
gtgagcaaggtgctggcgcgcaccggcctgggcttcgaccagatggacctgatcgagctg
aacgaggcgttcgcctgccaggcgctggcctgcgtcaagggctggggaagttcgatggac
gcgctggaggaccggctcaacgtcaacggctcgggcatttcgctgggccaccccgtcggc
gcgacgggcgtgcgcatcatgaccacgctgttgcacgaaatgcagcggtgcaaggcccgc
tacggcctggagaccatgtgcataggcggtggccagggcatagccatgattgtcgagcgc
gcctga

DBGET integrated database retrieval system