KEGG   Bordetella parapertussis Bpp5: BN117_0843Help
Entry
BN117_0843        CDS       T02297                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bpar03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(914779..915510)
Genome map
AA seq 243 aa AA seqDB search
MRWPIPPALPDLLAGRTVLECGRRGKYLLLRFDHGVQIVHLGMSGSLRRVPEQEAPRKHD
HVDWVFDHAVLRLHDPRRFGAVLWHPDEAGPIAAHPLLARLGIEPFDPRFDGRWLHAYFR
GRRVAIKQALLAGDAVVGVGNIYASESLFRAGIDPRTAAQRVSAARCDRLAAAIRATLSD
ALDSGGSTLRDYVGASGEPGAYFAIHAAVYERAGLPCRVCGTPIRRLVQGQRATYFCPSC
QKR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggcccattccacccgccctgcccgatctgctggccggccgcaccgtgctcgaa
tgcgggcggcgcggcaaatacctgctgctgcgcttcgaccatggcgtgcagatcgtgcat
ctgggcatgtccggatcgctgcgccgggtgcccgagcaggaggcgccgcgcaagcacgac
cacgtcgactgggtattcgaccacgccgtcctgcggctgcacgatccgcgccgcttcggc
gcggtgctgtggcaccccgacgaggccggcccgatcgccgcccacccgctgctggcccgc
ctgggcatcgaaccgttcgacccgcgctttgacgggcgctggctgcacgcctacttccgc
ggacgccgggtcgccatcaagcaggccctgctggccggcgacgccgtggtgggcgtgggc
aacatctacgcatcggaaagcctgtttcgcgccggcatcgatccgcgcacggccgcccag
cgcgtctcggcggcgcgctgcgaccggctggcggccgccatccgcgccaccctgtcggac
gcgctggattccggcggcagcacgctgcgcgactacgtcggcgccagcggcgagccgggc
gcgtatttcgccatccacgccgccgtctacgagcgcgccggcctgccctgccgcgtgtgc
ggcacgccgatccgccgcctggtgcagggccagcgcgccacgtatttctgtccgagctgc
cagaaacgctag

DBGET integrated database retrieval system