KEGG   Bordetella parapertussis Bpp5: BN117_1109Help
Entry
BN117_1109        CDS       T02297                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00040  Pentose and glucuronate interconversions
bpar00052  Galactose metabolism
bpar00500  Starch and sucrose metabolism
bpar00520  Amino sugar and nucleotide sugar metabolism
bpar01100  Metabolic pathways
bpar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN117_1109
   00052 Galactose metabolism
    BN117_1109
   00500 Starch and sucrose metabolism
    BN117_1109
   00520 Amino sugar and nucleotide sugar metabolism
    BN117_1109
Enzymes [BR:bpar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN117_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 13889145
NCBI-ProteinID: YP_006895113
UniProt: K0MEL1
Position
complement(1216063..1216902)
Genome map
AA seq 279 aa AA seqDB search
MQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRN
KRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAHVNCLYIRQSAPLGLGHAVLTAAP
AVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSVLGVQEVPREDTRKYGIVASQPVD
ARTERITHIVEKPAPEQAPTTLAVVGRYVLEAAIFDHLRATTVGAGNEIQLTDGIAALLR
ERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLIPE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgttttctgccc
gccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctgatccaatat
gccgtcgaagaagccgtcgccgctgggatcaccgacctcatcttcgtcacgggccgcaac
aagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgacctggaagcg
aagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcacgtgaactgc
ctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacggccgcgccg
gcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgacgccgacacg
ccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtgctgggcgta
caggaggtgccgcgcgaagacacgcgcaaatacggcatcgtggccagccagccagtcgat
gcgcgcaccgagcgtatcacccacatcgtcgagaaacccgcccccgagcaagcccccacc
accctggcggtcgtcggccgctatgtgctggaggcagccattttcgaccatctgcgtgcc
accacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcgctgctgcgc
gaacgcgacgtctatgcgcaccgctatgacggcaagcgctatgactgcggcagcaaggcg
ggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgattccggaataa

DBGET integrated database retrieval system