KEGG   Bordetella parapertussis Bpp5: BN117_1295Help
Entry
BN117_1295        CDS       T02297                                 

Definition
UTP-glucose-1-phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN117_1295
   00052 Galactose metabolism
    BN117_1295
   00500 Starch and sucrose metabolism
    BN117_1295
   00520 Amino sugar and nucleotide sugar metabolism
    BN117_1295
Enzymes [BR:bpar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN117_1295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1414338..1415171)
Genome map
AA seq 277 aa AA seqDB search
MHTVRKAVFPVAGLGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITELIFVTGRN
KRAIEDHFDRAPELERDLEEKNKLAMLDMVRHVIPPDVKCVYTRQPAALGLGHAVLCAAP
IVGREPFAVLLADDLIDAPRAVIGEMMKVAREFQGSVLALQRVPSRSTSQYGIVAGKTVS
GAIMQVEEIVEKPAPAQAPSDMAVVGRYVLDWRIFAALENTRPGVGGEIQLTDAIATLLD
DPGVFGYAYDGVRYDCGSKEGFYRATMDLGRKYHGMQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgtgcgcaaagctgtctttcccgtcgccggactgggcacgcgattcctgccc
gccaccaaggccatgcccaaggaaatgctgcccgtcgtcgacaagccgctgatccagtac
gccgtcgaggaagccgtggcggccggcatcaccgaactgattttcgtcacgggtcgcaac
aagcgcgccatcgaggatcacttcgaccgggcgccggagctcgagcgcgacctggaagag
aagaacaagctggccatgctcgacatggtgcgccacgtcatcccgcccgacgtcaagtgc
gtctacacgcggcaaccggcggccttggggctggggcatgccgtcctgtgcgcggcgccc
atcgtggggcgcgagccgttcgcggtcctgctggccgacgacctgatcgacgcgccgcgc
gcggtcatcggcgagatgatgaaggtcgcgcgcgaattccagggcagcgtgctggccctg
cagcgcgtgccgtcacgcagcaccagccagtacggcatcgtcgcgggcaagacggtatcg
ggcgcgatcatgcaagtggaagagatcgtcgaaaagcccgcacccgcgcaggcgccctcg
gacatggcggtcgtcggccgctatgtgctggactggcgcatcttcgcggcgctggaaaac
acccgtccgggcgtgggcggcgaaatccagcttaccgatgccatcgccaccctgctggac
gacccgggcgtgttcggctacgcctacgacggcgtgcgctacgactgcggcagcaaggaa
gggttctaccgcgccaccatggacctgggcaggaaataccacggcatgcaatag

DBGET integrated database retrieval system