KEGG   Bordetella parapertussis Bpp5: BN117_1542Help
Entry
BN117_1542        CDS       T02297                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bpar00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpar02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675375..1675785
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAASAAARAAAPDPVRGEQVYARCLACHALPYDRVGPRHCGLLGR
KAGSVPGFAYTQAMEDSGLTWDATTLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggctgcgtcggcg
gccgcgcgggccgcagcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctgccctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggcttcgcctatacgcaagccatggaagactccggcctgacc
tgggacgccaccacgctcgaccgcttcctggccgatcccttgaagacggtgccaggcacc
gccatgacttacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccacattag

DBGET integrated database retrieval system