KEGG   Bordetella parapertussis Bpp5: BN117_1542Help
Entry
BN117_1542        CDS       T02297                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BN117_1542
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN117_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675375..1675785
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAASAAARAAAPDPVRGEQVYARCLACHALPYDRVGPRHCGLLGR
KAGSVPGFAYTQAMEDSGLTWDATTLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggctgcgtcggcg
gccgcgcgggccgcagcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctgccctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggcttcgcctatacgcaagccatggaagactccggcctgacc
tgggacgccaccacgctcgaccgcttcctggccgatcccttgaagacggtgccaggcacc
gccatgacttacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccacattag

DBGET integrated database retrieval system