KEGG   Bordetella parapertussis Bpp5: BN117_1589Help
Entry
BN117_1589        CDS       T02297                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpar00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bpar00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1733588..1734724
Genome map
AA seq 378 aa AA seqDB search
MFEARLTDVRANKLAQAWRLAYEQADGKRRRAMLGGLAQVGAGMQGDGAQGTRLFKRFNA
LPDGLRFLVALRADMLRWRKQVAGLQALDKELEALLSAWFDVGLLELRPLTWDSPASLLE
KLILYEAVHEIRSWDDLRHRVAGDRRCYAYFHPQMPDVPLIFVEVAFSAQMADNVQALLD
TSAPPQDLDKARWAIFYSISNTQPGLRGISFGNFLLKRVIDRLLQELPKLKFFATLSPIP
GFADWLSRLDAQEVEQAVRDKARTRSGAPDGARWVARLARAATGKPSEVVQRAGLRLAAR
YLQAMRAGQPLDPVARFHLGNGARIERLNWAADTSAKGLAQSCGMMVNYLYELGDLDGNL
ARLNEGKPQVSRGIARLG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaggcgcgcctgaccgatgtgcgcgccaacaaactggcgcaggcctggcgcctg
gcctatgagcaggccgacggcaagcggcgccgcgccatgctgggcgggctggcgcaggtc
ggcgccggcatgcagggcgacggcgcgcagggcacgcgcctgttcaaacggttcaatgcc
ttgcccgacggactgcgtttcctggtggcgctgcgcgccgacatgctgcgctggcgcaag
caggtcgccggactgcaggccctggacaaggagctggaggcgctgctgtcggcctggttc
gacgtgggcctgctggagctgcgcccgctgacctgggactcgcccgcctcgctgctcgag
aagctgatcctctacgaggccgtgcacgaaatccgctcgtgggacgatctgcgccatcgg
gtggcgggcgaccgccgctgctacgcgtatttccatccgcagatgccggacgtgccgctg
atcttcgtggaggtggcgttttcggcccagatggccgacaacgtccaggcgctgctcgac
accagcgcgccgccgcaggacctggacaaggcgcgctgggcgatcttctattccatctcg
aatacgcagcccggcctgcgcgggatcagcttcggcaacttcctgctcaagcgcgtgatc
gaccgcctgctgcaggagctgcccaagctgaaattcttcgccacgctgtcgcccattccc
ggcttcgccgactggctgtcgcggctggacgcgcaggaggtcgagcaggcggtgcgcgac
aaggcgcgcacgcgcagcggcgctccggatggcgcgcgctgggtggcgcggctggcgcgc
gcggccacgggcaagccgtcggaagtggtgcagcgagccggcctgcgcctggccgcgcgc
tacctgcaggcgatgcgggccggccagccgctcgacccggtggcccgtttccacctgggc
aacggcgcgcgcatcgagcgcctgaactgggctgccgatacctcggccaagggcctggcg
cagtcctgcggcatgatggtgaactacctctacgagctgggcgacctggatggcaacctg
gcccgcctgaacgaaggcaagccgcaagtcagccgcggcatcgcgcgcctgggatga

DBGET integrated database retrieval system