KEGG   Bordetella parapertussis Bpp5: BN117_1805Help
Entry
BN117_1805        CDS       T02297                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN117_1805 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN117_1805 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN117_1805 (thrC)
Enzymes [BR:bpar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN117_1805 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1964800..1966206
Genome map
AA seq 468 aa AA seqDB search
MKYISTRGGMAPQSFSDILLEGLAPDGGLAIPEQLPQVDAATLESWRGLSYADLAFEVLS
LFATDIPAEDLRGLTRAAYRQGVFKSEDIVPVRELGQGLQLLGLSEGPTLAFKDMAMQFL
GQVFEYVLTRRGTTLNIVGATSGDTGSAAEYALRGKQGVAVFMLSPHGRMSAFQRAQMYS
LQDENIHNIAVRGVFDQAQDIVKQLAGDLAFKTRYRLGAVNSINWARIAAQVVYYFHGWL
RAAPKGGEVSFAVPSGNFGNILSGHIARGMGVPIRRLVLATNENNVLEEFFRTGVYRPRG
PEHTYATSSPSMDISRASNFERFVFDLVGRDPGRVASLWADLARDGSFDLSALKPQFETR
YGFVAGASSHADRLQTIRNTFDETGVLVDPHTADGIKVARQFVEPGVPMLVLETALPAKF
AETIEAALGRTVPPPADLADLESLPQRVTLMDCDAQAVRAFIEAHAKV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatctcgacccgcggcggcatggccccgcagagtttctccgacatcctgctc
gaaggcctggcgcccgacggcgggctggccatccccgagcagctgccgcaagtcgacgcg
gccacgctggagtcctggcgcgggctctcgtacgccgacctggccttcgaagtgctgtcg
ctgttcgccaccgacatcccggccgaggacctgcgcgggctgacgcgcgcggcctaccgg
cagggcgtgttcaagagcgaagacatcgtcccggtgcgcgagctggggcaggggctgcag
ctgctgggcctgtccgaggggcccacgctggccttcaaggacatggcgatgcagtttctc
ggccaggtcttcgaatacgtcctgacgcggcgcggcaccacgctgaacatcgtcggcgcc
acctccggcgataccgggtcggcggccgagtacgcgctgcgcggcaagcagggcgtggcc
gtgttcatgctgtcgccgcacggccgcatgagcgcattccagcgcgcccagatgtactcg
ctgcaggatgagaacatccacaatatcgcggtgcggggcgtgttcgaccaggcgcaggac
attgtcaagcagctggccggcgacctggcgttcaagacgcgctatcgcctgggcgcggtc
aactcgatcaactgggcgcgcatcgccgcccaggtggtgtactacttccacggctggctg
cgtgccgcgcccaagggtggcgaggtgtcgttcgcggtgccttcgggcaacttcggcaac
atcttgtccgggcacatcgcgcgcggcatgggcgtgccgatccgccgcctggtgctggcc
accaacgagaacaacgttctcgaggagttcttccgcaccggcgtttaccgcccgcgcggt
cccgagcacacctacgccacctccagcccgtcgatggacatctcgcgcgcctcgaacttc
gagcgcttcgtgttcgacctggtcgggcgcgaccccggccgcgtggcgtcgctgtgggcc
gacctggcgcgcgacggcagcttcgacctgtcggcgctcaagccgcagttcgaaacccgc
tacgggttcgtggccggcgccagctcgcacgccgaccgcctgcagaccatacgcaatacc
ttcgacgaaaccggcgtgctggtcgacccgcacacggccgatggcatcaaggtggcgcgc
cagttcgtcgagccgggcgtgcccatgctggtgctcgagacggccctgccggccaagttc
gcggaaaccatcgaggcggcgctcgggcgcaccgtgccgccgccggctgacctggccgac
ctcgaatcgctgccccaacgcgtgacgctcatggactgcgacgcgcaggcggtgcgggcc
ttcatcgaggcccacgccaaagtgtaa

DBGET integrated database retrieval system