KEGG   Bordetella parapertussis Bpp5: BN117_1831Help
Entry
BN117_1831        CDS       T02297                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN117_1831
Enzymes [BR:bpar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN117_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2007456..2008067)
Genome map
AA seq 203 aa AA seqDB search
MKLIGSLTSPYVRKVRVVMAEKKLDYQLELENVWSPDSQVQKYNPLGKVPCLVMEDGGAL
FDSRVIVEYLDTLSPVARLIPQPGRERAAVKCWEAIADGLLDACVTVVRERLRPAAQQSP
EWIERQYGKVRASLDAMDHSLGENAHCMGVNYSLADIAVGCALGYLDLRFADLDWRADHA
NLARLYEKLSARPSFVDSMPPTA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatcggctcacttaccagtccttacgtccgcaaagtgcgggtcgttatggca
gaaaagaagctggactaccagctcgaactggagaacgtctggtcgcctgattcgcaggta
cagaagtacaacccgctgggcaaggtaccctgcctcgtcatggaagacggcggcgcgctg
ttcgattcgcgcgtgatcgtcgaatacctcgataccctgtctccggtggcgcggctgatt
ccgcagccgggccgcgaacgagcggccgtcaagtgctgggaagccatcgccgacggcctg
ctcgacgcctgcgtcaccgtcgtgcgcgaacgcctgcgcccggccgcgcagcaaagcccc
gaatggatcgagcgccagtacggcaaggtgcgcgccagcctggacgccatggaccacagc
ctgggcgaaaacgcccactgcatgggcgtgaactacagcctggccgacatcgccgtgggc
tgcgcgctgggctatctggacttgcgctttgcggacctggactggcgcgccgatcacgcc
aacctggcccgcctgtatgaaaagctgtcggcacgcccatccttcgtcgacagcatgccg
ccgaccgcctga

DBGET integrated database retrieval system