KEGG   Bordetella parapertussis Bpp5: BN117_1839Help
Entry
BN117_1839        CDS       T02297                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BN117_1839
Enzymes [BR:bpar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BN117_1839
    3.5.1.-  
     BN117_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2015081..2015728
Genome map
AA seq 215 aa AA seqDB search
MKLPVDGLIASFDVDAQKSFTPLCPDELPVPDGHAIVPELNAQAAHADLRLGSKDAHSPH
AIWRATADQPMFSPVAGANVDVRWNMHCVPGTRGFELLDGLPVPAAYDFFVWKGVEPDMH
PYGSCYHDLAERQPTGVIEFLRARDVRCVLVGGLALDYCVKVTALQLRRAGLEVVVNLAA
CRGIAAATCEQARRELSQAGVRTVPHAGVLVRAGR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgcctgtcgacgggctgatcgcgtcgttcgacgtggatgcgcaaaagagtttc
acgccgctttgcccggatgaactgccggtgcccgacgggcacgcgatcgtccctgaactc
aacgcccaggcggcgcacgcggatctgcgcctgggatcgaaagatgcgcacagccctcac
gccatctggcgggcgacggccgatcaacccatgttcagcccggtggcgggcgccaacgtc
gacgtgcgctggaacatgcactgcgtgccgggcacgcgcggcttcgagctgctcgacggc
ttgccggtgccggccgcctacgatttcttcgtctggaaaggcgtggagcccgacatgcat
ccgtacgggtcttgttaccacgacttggccgagcggcagccgaccggcgtcatcgagttc
ctgcgcgcgcgcgacgtgcgctgcgtgctggtgggcggcctggcgctggattactgcgtc
aaggtgacggccctgcagctgcgtcgcgccgggctggaggtcgtggtcaatctggcggcg
tgccgcggcattgccgccgccacgtgcgaacaggccaggcgggagctgagccaggccggg
gtgcgcaccgtgccgcatgccggcgtgctggtgcgcgccggccgctga

DBGET integrated database retrieval system