KEGG   Bordetella parapertussis Bpp5: BN117_1839Help
Entry
BN117_1839        CDS       T02297                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bpar00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2015081..2015728
Genome map
AA seq 215 aa AA seqDB search
MKLPVDGLIASFDVDAQKSFTPLCPDELPVPDGHAIVPELNAQAAHADLRLGSKDAHSPH
AIWRATADQPMFSPVAGANVDVRWNMHCVPGTRGFELLDGLPVPAAYDFFVWKGVEPDMH
PYGSCYHDLAERQPTGVIEFLRARDVRCVLVGGLALDYCVKVTALQLRRAGLEVVVNLAA
CRGIAAATCEQARRELSQAGVRTVPHAGVLVRAGR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgcctgtcgacgggctgatcgcgtcgttcgacgtggatgcgcaaaagagtttc
acgccgctttgcccggatgaactgccggtgcccgacgggcacgcgatcgtccctgaactc
aacgcccaggcggcgcacgcggatctgcgcctgggatcgaaagatgcgcacagccctcac
gccatctggcgggcgacggccgatcaacccatgttcagcccggtggcgggcgccaacgtc
gacgtgcgctggaacatgcactgcgtgccgggcacgcgcggcttcgagctgctcgacggc
ttgccggtgccggccgcctacgatttcttcgtctggaaaggcgtggagcccgacatgcat
ccgtacgggtcttgttaccacgacttggccgagcggcagccgaccggcgtcatcgagttc
ctgcgcgcgcgcgacgtgcgctgcgtgctggtgggcggcctggcgctggattactgcgtc
aaggtgacggccctgcagctgcgtcgcgccgggctggaggtcgtggtcaatctggcggcg
tgccgcggcattgccgccgccacgtgcgaacaggccaggcgggagctgagccaggccggg
gtgcgcaccgtgccgcatgccggcgtgctggtgcgcgccggccgctga

DBGET integrated database retrieval system