KEGG   Bordetella parapertussis Bpp5: BN117_1938Help
Entry
BN117_1938        CDS       T02297                                 

Gene name
pyrB
Definition
(RefSeq) aspartate transcarbamoylase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00240  Pyrimidine metabolism
bpar00250  Alanine, aspartate and glutamate metabolism
bpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BN117_1938 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN117_1938 (pyrB)
Enzymes [BR:bpar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BN117_1938 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace HTH_31 Mig-14
Motif
Other DBs
NCBI-GeneID: 13889975
NCBI-ProteinID: YP_006895881
UniProt: K0M8Y0
Position
2119351..2120670
Genome map
AA seq 439 aa AA seqDB search
MYSFLGPPMSISQQAFLRDAMRRLNLTRDVFAGRIGVKRRALDTWLLPEGSQEFRAMPEV
VERFVSEIVQNRDLLEKYMQSGQVGPLRDRIAVEGRHQLLSVDQFTRESVEDLFRVADMM
QPIARRQKVSRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGES
IYDTSRVMSGYVDAMVIRHPEQGSVAEFAQATNIPVVNGGDGPGEHPSQALLDLYTILTE
FSRLGKLLDGAHIAMVGDLKYGRTVHSLIKLLALYKGVKFTLISPQGLEMPDYIVEQASR
NGNVIEQKSTLAEGLAGADVIYATRVQKERFANEEAGEGYTADFQVSRAIIDAYCGPDTI
VMHPLPRDSRPGSNDLSTDLNHDPRLAIFRQTDNGIPIRMAIFAVLLGVEGLVQHSMRDV
TWQHPSHIGPDDSVFHGLD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgtattccttcctggggccgcccatgtccatttcccaacaagcctttctgcgcgacgcg
atgcgtcgcctcaacctgacgcgcgacgtgttcgccggccgcatcggcgtcaaacgccgc
gcgctggatacgtggctgttgcccgaagggtcgcaggaatttcgcgcgatgcccgaagtg
gtggagcgctttgtcagcgaaatcgtgcagaaccgcgacttgctggagaaatatatgcag
agcgggcaggtgggccccttgcgcgaccgcattgccgtcgaagggcgtcatcagctgctg
tcggtcgaccagttcacccgcgaatcggtggaagacctgttccgcgtggcggacatgatg
caacccattgcgcgccgccagaaggtgtcgcgggtgctggaaggcgcggtgctgggcaac
ctgttcttcgaggccagcacgcggactcgcgtcagcttcggcgcggcgttctgccgcctg
ggcggctcggtctgcgacaccacgggcttcacgttctcgtccatggccaagggcgagtcc
atctacgatacgagccgcgtgatgagcggctacgtggacgccatggtcatccgccatccc
gagcaggggtcggtggcggagttcgcccaggcgaccaatatcccggtggtcaatggcggc
gacggcccgggcgagcatcccagccaggccctgctggatctgtacaccatccttaccgag
ttctcgcgcctgggcaagctgctcgacggcgcgcacatcgccatggtcggcgacctgaag
tacggccgcacggtgcactcgctgatcaagctgctggcgttgtacaagggcgtgaagttc
acgctgatctcgccgcaggggctggagatgcccgactacatcgtcgagcaggccagccgc
aacggcaatgtgatcgagcagaaaagcacgctggccgagggcctggcgggcgcggacgtc
atttacgccacgcgtgtgcagaaagagcgcttcgccaacgaagaggcgggcgaaggctat
acggcggacttccaggtcagccgcgccatcatcgacgcctactgcggtccggataccatc
gtcatgcaccccttgccgcgcgacagccggccggggtccaacgatctgagcacggatctg
aaccacgacccgcgcctggcgattttccgccagaccgacaatggcattccgatccggatg
gcgatcttcgcggtgctgctgggcgtggaagggctggtgcagcattcgatgcgcgacgtg
acgtggcagcatccgtcgcacatcggccccgacgactcggtattccacggcctggactag

DBGET integrated database retrieval system