KEGG   Bordetella parapertussis Bpp5: BN117_1960Help
Entry
BN117_1960        CDS       T02297                                 

Gene name
sucC
Definition
(RefSeq) Succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00020  Citrate cycle (TCA cycle)
bpar00640  Propanoate metabolism
bpar00660  C5-Branched dibasic acid metabolism
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01120  Microbial metabolism in diverse environments
bpar01130  Biosynthesis of antibiotics
bpar01200  Carbon metabolism
Module
bpar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN117_1960 (sucC)
   00640 Propanoate metabolism
    BN117_1960 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BN117_1960 (sucC)
Enzymes [BR:bpar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BN117_1960 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 Cation_ATPase_N
Motif
Other DBs
NCBI-GeneID: 13889997
NCBI-ProteinID: YP_006895902
UniProt: K0MEU4
Position
2143842..2145002
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKELLKQFGVTVPRGIPAFSVDEAVAAAEKLGGPVWVVKAQIHAGGRGKGGGV
KLGRSIDEVRQLSSEILGMQLVTHQTGPQGQKVRRLLIEEGADIKKEYYVGIVTDRGTQR
VCVMASSEGGMDIEEVAAHSPEKILKVFVDPAAGLTDAEAAELVRGIGVPEASVGKAAAE
FQKLYKAYWDTDASLAEINPLILTGSGDIIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNKSVKAILVNIFGGIMRCDVIAEGVITACKAVNLNVPLVVRMKGTNEELGKKM
LAESGLPIISADTMAEAATKVVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccacgagtatcaaggcaaggaactgctgaagcagtttggcgtgaccgtgccg
cgcgggatccccgctttttccgtagacgaggccgtggctgccgctgaaaagctgggtggg
ccggtctgggtcgtcaaggcgcagatccacgcgggtggccgtggcaagggcggtggcgtc
aaactggggcgttcgatcgacgaagtgcgccagctgtcgtcggagatcctcggcatgcag
ctggtcacgcaccagaccggcccgcaaggccagaaagtgcgccgcctgctgatcgaagag
ggcgcggacatcaagaaggaatactacgttggcatcgtgaccgaccgtggcacgcagcgc
gtgtgcgtcatggcttccagcgaaggcggcatggacatcgaggaagtggccgcgcacagc
ccggagaagatcctgaaggtcttcgttgatccggccgccggcctgaccgacgccgaggcc
gccgaactggtgcgcggcatcggcgtgcccgaagcctccgtgggcaaggctgccgccgaa
ttccagaagctgtacaaggcgtactgggacaccgacgcctcgctggctgaaatcaacccc
ctgatcctgaccggcagcggcgacatcatcgcgctggacgccaagttcaacttcgattcg
aacgcgctgttccgccaccccgagatcgtggcctaccgtgatctggacgaggaagacccg
gccgaaatcgaagccagcaagttcgacctggcctatatccagctcgacggcaacatcggt
tgcctggtcaacggcgccggcctggccatggccaccatggataccatcaagctgttcggc
ggagagccggccaacttcctggacgtcggcggtggcgccacggccgagaaggtcaccgaa
gcattcaagatcatgctcaagaacaagagcgtgaaggcgattctggtcaacatcttcggc
ggcatcatgcgctgcgacgtgatcgccgaaggcgtgatcacggcgtgcaaggcggtcaac
ctgaatgtgccgctggtcgtgcgcatgaagggcaccaacgaagagctcggcaagaaaatg
ctggccgaatcgggcctgccgatcatcagcgccgacacgatggccgaagcggccaccaaa
gtcgttgccgccgtcaaataa

DBGET integrated database retrieval system