KEGG   Bordetella parapertussis Bpp5: BN117_1965Help
Entry
BN117_1965        CDS       T02297                                 

Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00860  Porphyrin and chlorophyll metabolism
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01120  Microbial metabolism in diverse environments
Module
bpar_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN117_1965
Enzymes [BR:bpar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN117_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 13890002
NCBI-ProteinID: YP_006895907
UniProt: K0MEU7
Position
2148812..2149636
Genome map
AA seq 274 aa AA seqDB search
MTGRSGPRGGLPMSQIAILTRPQGRNGALAQRLHEAGWQTLCLPALRIEPLPPENGAVPL
PRDYDLVVFVSGNAARLYLEQLGERGQLPWPAGAVAATVGPASARALLDSGQFGADTTVL
HPAETAPTHDSEALWALLRARPALPRRALLVRGTQGRDWLADRLAAAGVEVSRHAVYRRR
PAPWAQEGRQRLRDWARAGERPTWLLTSGEGIDALVQGLREEQLLDWWLQGRFVVTHPVL
AERLRALAGGGADAPMVKNCMPADEAIFATFVAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgacagggcggtcgggccctcgcgggggcttgcctatgtcgcagattgccatcctgaca
cggccgcaaggccgcaatggcgcgcttgcgcaacgcctgcacgaggccggctggcagacc
ctttgcctgccggccttgcgcatcgagccgttgccgcccgaaaatggcgcggtgccgctg
ccgcgcgactacgacctggtggtgtttgtcagcggcaacgcggcgcgcctgtacctggag
cagctgggggagcgggggcaattgccatggccggcaggcgcggtcgccgccaccgtgggc
ccggccagcgcccgcgccctgctggattcgggccagtttggcgccgatacaacagttttg
caccctgcggaaaccgcgcccacccacgattcggaagccttgtgggccttgttgcgggcg
cgcccggcattgccgcgccgcgcgctgctggtgcgcggcacccaagggcgcgactggctg
gccgatcgcctggccgcggctggcgtggaggtcagccgccacgcggtctaccgccggcgg
cccgcgccctgggcgcaggaggggcgccagcgcctgcgcgactgggcccgggcgggcgag
cgcccgacctggctgctcaccagcggcgagggcatcgacgcgctggttcagggcctgcgc
gaggagcaattgctggactggtggctgcaaggccgtttcgtcgtcacgcatcccgtgctg
gccgagcggctgcgggcgctggccggtggcggggccgatgcgccaatggtaaaaaactgc
atgcctgccgatgaggcgatcttcgcgacttttgttgcggcttga

DBGET integrated database retrieval system