KEGG   Bordetella parapertussis Bpp5: BN117_1965Help
Entry
BN117_1965        CDS       T02297                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bpar00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2148812..2149636
Genome map
AA seq 274 aa AA seqDB search
MTGRSGPRGGLPMSQIAILTRPQGRNGALAQRLHEAGWQTLCLPALRIEPLPPENGAVPL
PRDYDLVVFVSGNAARLYLEQLGERGQLPWPAGAVAATVGPASARALLDSGQFGADTTVL
HPAETAPTHDSEALWALLRARPALPRRALLVRGTQGRDWLADRLAAAGVEVSRHAVYRRR
PAPWAQEGRQRLRDWARAGERPTWLLTSGEGIDALVQGLREEQLLDWWLQGRFVVTHPVL
AERLRALAGGGADAPMVKNCMPADEAIFATFVAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgacagggcggtcgggccctcgcgggggcttgcctatgtcgcagattgccatcctgaca
cggccgcaaggccgcaatggcgcgcttgcgcaacgcctgcacgaggccggctggcagacc
ctttgcctgccggccttgcgcatcgagccgttgccgcccgaaaatggcgcggtgccgctg
ccgcgcgactacgacctggtggtgtttgtcagcggcaacgcggcgcgcctgtacctggag
cagctgggggagcgggggcaattgccatggccggcaggcgcggtcgccgccaccgtgggc
ccggccagcgcccgcgccctgctggattcgggccagtttggcgccgatacaacagttttg
caccctgcggaaaccgcgcccacccacgattcggaagccttgtgggccttgttgcgggcg
cgcccggcattgccgcgccgcgcgctgctggtgcgcggcacccaagggcgcgactggctg
gccgatcgcctggccgcggctggcgtggaggtcagccgccacgcggtctaccgccggcgg
cccgcgccctgggcgcaggaggggcgccagcgcctgcgcgactgggcccgggcgggcgag
cgcccgacctggctgctcaccagcggcgagggcatcgacgcgctggttcagggcctgcgc
gaggagcaattgctggactggtggctgcaaggccgtttcgtcgtcacgcatcccgtgctg
gccgagcggctgcgggcgctggccggtggcggggccgatgcgccaatggtaaaaaactgc
atgcctgccgatgaggcgatcttcgcgacttttgttgcggcttga

DBGET integrated database retrieval system