KEGG   Bordetella parapertussis Bpp5: BN117_2057Help
Entry
BN117_2057        CDS       T02297                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bpar01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bpar01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2241065..2242273
Genome map
AA seq 402 aa AA seqDB search
MDSILSFISGGLTQATWWQIVLFTLVVTHITIVSVTVFLHRSQAHRGLDLHPAVMHFFRF
WLWMTTGMVTKEWVAIHRKHHAKCEKEGDPHSPMLFGIWKVLFRGAELYREESANKETMA
KFGHGTPDDWLERNIYSKHSLAGVLTMLAIDLALFGAVGLTVWAVQMAWIPFWAAGVVNG
IGHYWGYRNYNSPDTSTNVFPWGIIIGGEELHNNHHAHGTSAKFSAKWYELDIGWGYISI
LKFFGLAKVKKVAPKLKLESGSKGIDLSTLQGVITHRYEVMARYGDLVKRAAREELSKLK
SSRQQDAANCRWTTLRRVRRWLHRNEEVLQPEQRAEVDQAIAQNQSLSTLVQMRRELGRL
WESSSASSEQLLHDLQAWCQRAQQSGIAGLEQFALHLRRYAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggattccatcctttctttcatttccggtggtctgacccaagccacttggtggcagatc
gtgctgttcaccctggtcgtgacgcacatcaccattgtgtcggtcacggtgttcctgcac
cgcagccaggcgcaccgcggcctggacctgcatccggcagtgatgcatttcttccgcttc
tggctctggatgaccaccggtatggtcaccaaggagtgggtcgccatccaccgcaagcac
cacgccaagtgcgagaaggaaggcgatccccattcgccgatgctgttcggcatctggaag
gtgctgttccgcggcgccgagctgtatcgggaggagtccgccaacaaggaaaccatggcc
aagttcggccacggcacgcccgatgactggctcgaacgcaacatctattccaagcacagc
ctggccggcgtgctcaccatgctggccatcgacctggccctgttcggggcggtcggcctg
acggtctgggcggtgcagatggcctggatcccgttctgggcggccggcgtggtcaatggc
atcggccattactggggctaccgcaactacaacagcccggacaccagcaccaacgtgttc
ccgtggggcatcatcatcggcggcgaagagctgcacaacaaccaccacgcgcacggcacc
tcggccaagttctcggccaagtggtacgagctggacatcggctggggctatatcagcatc
ctgaagttcttcggcctggccaaggtcaagaaggttgcgcccaagctgaagctggaatcg
ggcagcaagggcatcgacctgagcacgctgcaaggcgtgatcacgcaccgctacgaagtc
atggcccgctacggcgacctggtcaagcgcgccgcgcgtgaagagctgagcaagctgaag
tcctcgcgccagcaggacgccgccaattgccgctggaccacgctgcgccgcgtgcgccgc
tggctgcaccgcaacgaggaagtcctgcagcccgagcagcgcgccgaagtcgaccaggcc
atcgcccagaaccagtcgctgtcgacgctggtgcagatgcgccgcgaactcggccgtctc
tgggaaagctccagcgccagcagcgagcagctgttgcatgacctgcaggcctggtgccag
cgcgcccagcaaagcggcatcgccgggctcgagcaatttgctctgcatctgcgccgctac
gcggcatga

DBGET integrated database retrieval system