KEGG   Bordetella parapertussis Bpp5: BN117_2341Help
Entry
BN117_2341        CDS       T02297                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bpar  Bordetella parapertussis Bpp5
Brite
Enzymes [BR:bpar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BN117_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 13890378
NCBI-ProteinID: YP_006896253
UniProt: K0MFU8
Position
2531141..2531836
Genome map
AA seq 231 aa AA seqDB search
MIDLYFWATPNGLKIKLFLEEAGLPYTEHPINIGKGEQFQREFLAIAPNNRIPAIVDQAP
AGGGAPISLFESGAILLYLAEKIGRFIPADVRGRAEVLQWLFWQMGGLGPMAGQNGHFNV
YAPEKVPYAIERYTAETARLYDVMDRRLAEREFLAGEYSIADIACYPWVVPHEAHGQKMA
HFPHLSRWFEAIAARPATARAYKEAGDSYRPKAPMSDEERAVLFGQPGAPR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctgtatttctgggccacgcccaatggtttgaaaataaaactcttcctggaa
gaggccggcctgccctataccgagcacccgatcaacatcggcaagggcgagcagttccag
cgcgaattcctcgcgatcgcgcccaacaaccgcattcccgccatcgtcgaccaggcgccg
gctggcggcggcgcgccgatctcgttgttcgagtccggcgccatcctgctgtacctggcc
gagaagatcggccgcttcatccccgccgacgtgcgcggccgcgccgaagtcctgcagtgg
ctgttctggcagatgggcgggctggggcccatggccggccagaatgggcatttcaacgtc
tatgcccccgagaaggtgccgtacgccatcgaacgctacacggccgaaaccgcgcgcctg
tacgacgtgatggaccggcgcctggccgagcgcgagttcctggcgggcgagtactcgatc
gccgatatcgcctgctatccctgggtcgtgccgcacgaggcgcacggccagaagatggcc
catttcccgcacctgagccgctggttcgaggcgatcgccgcgcggcccgccacggcgcgc
gcctataaggaggccggcgacagctaccggcccaaggcgcccatgtcggacgaggaacgg
gccgtactgttcggccagccgggcgcgccgcgctag

DBGET integrated database retrieval system